Juglans regia (English walnut): 109001528 Help Entry 109001528         CDS       T05245                                  Name (RefSeq) sm-like protein LSM7   KO K12626   U6 snRNA-associated Sm-like protein LSm7 Organism jre  Juglans regia (English walnut) Pathway jre03018   RNA degradation jre03040   Spliceosome Brite KEGG Orthology (KO) [BR:jre00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     109001528   09123 Folding, sorting and degradation    03018 RNA degradation     109001528  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:jre03019]     109001528    03041 Spliceosome [BR:jre03041]     109001528 Messenger RNA biogenesis [BR:jre03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      109001528   mRNA degradation factors    5'-3' decay     Lsm complex      109001528 Spliceosome [BR:jre03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     109001528 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM DUF150_C Hfq Motif Other DBs NCBI-GeneID:  109001528 NCBI-ProteinID:  XP_018834402 UniProt:  A0A2I4FRX2 A0A833X7P0 LinkDB All DBs Position 14:403495..407662 Genome browser AA seq 100 aa AA seqDB search MSGSRKETVLDLAKFVDKGVQVKLTGGRQVTGTLKGYDQLLNLVLDEAIEFTRDPDDPLK TTDQTRRLGLIVCRGTAVMLVSPTDGTDEIANPFVQPDGA NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgtcaggaagcaggaaggaaacggttttggacttggcaaagtttgtggacaaaggtgtc caagtcaagctcactggtggtagacaagtgaccgggactctaaaaggatatgaccaatta ctaaaccttgttctggacgaagccatagagtttacgagagatcctgatgatccactgaag actactgatcagaccaggcgtctaggccttatagtttgcaggggaaccgctgtaatgctt gtgtcccccacagatggtactgatgagattgccaatcctttcgtccagccagatggggcc tag

DBGET integrated database retrieval system