Juglans regia (English walnut): 109006046 Help Entry 109006046         CDS       T05245                                  Name (RefSeq) sm-like protein LSM5   KO K12624   U6 snRNA-associated Sm-like protein LSm5 Organism jre  Juglans regia (English walnut) Pathway jre03018   RNA degradation jre03040   Spliceosome Brite KEGG Orthology (KO) [BR:jre00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     109006046   09123 Folding, sorting and degradation    03018 RNA degradation     109006046  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:jre03019]     109006046    03041 Spliceosome [BR:jre03041]     109006046 Messenger RNA biogenesis [BR:jre03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      109006046   mRNA degradation factors    5'-3' decay     Lsm complex      109006046 Spliceosome [BR:jre03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     109006046 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM DUF7452 Ntox4 Motif Other DBs NCBI-GeneID:  109006046 NCBI-ProteinID:  XP_018840740 UniProt:  A0A2I4HRQ0 LinkDB All DBs Position 1:16372288..16375944 Genome browser AA seq 88 aa AA seqDB search MAANNPSQLLPSELIDRCIGSKIWVIMKGDKELVGTLRGFDVYVNMVLEDVTEYEITAEG RRITKLDQILLNGNNIAILVPGGSPDPE NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atggccgctaacaatccttcgcagctgctcccgtcagaactaattgataggtgcattggg tcgaagatatgggtgataatgaagggggacaaggagctcgttggtactctcaggggcttc gacgtctacgtcaatatggtactcgaagacgtcacagagtatgagatcactgctgaaggg agacggataacaaagcttgatcagattttactaaatggaaacaacattgccattctcgta cctggtggttcgcctgatccagaatga

DBGET integrated database retrieval system