Juglans regia (English walnut): 109007586 Help Entry 109007586         CDS       T05245                                  Name (RefSeq) 10 kDa chaperonin-like   KO K04078   chaperonin GroES Organism jre  Juglans regia (English walnut) Brite KEGG Orthology (KO) [BR:jre00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:jre03110]     109007586    03029 Mitochondrial biogenesis [BR:jre03029]     109007586 Chaperones and folding catalysts [BR:jre03110]  Heat shock proteins   HSP10    109007586 Mitochondrial biogenesis [BR:jre03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     109007586 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 Motif Other DBs NCBI-GeneID:  109007586 NCBI-ProteinID:  XP_018842878 UniProt:  A0A2I4GG47 LinkDB All DBs Position 16:7160203..7161087 Genome browser AA seq 97 aa AA seqDB search MAKRLIPTLNRVLVEKVLPPTKTSAGILLPEKASKLNSGKVVAVGPGARDRVGNLLPVSV KEGDTVLLPEYGGTQVNLGDKEFHLYRDEDILGTLHD NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atggcgaagcgtctgattccgacactcaaccgtgtcctagtcgagaaagtcctgcccccg accaaaacctccgccggcattcttctccctgagaaagcctccaagttgaactccgggaaa gttgttgcggtgggaccgggagcacgggatagggtggggaatctgttaccagtgtctgtg aaggagggtgacactgttcttttgccagagtatgggggtacccaagttaatcttggtgac aaagagttccatttatacagggatgaggacatcttgggcactcttcatgactga

DBGET integrated database retrieval system