Juglans regia (English walnut): 109010441 Help Entry 109010441         CDS       T05245                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism jre  Juglans regia (English walnut) Pathway jre04145   Phagosome jre04148   Efferocytosis jre04620   Toll-like receptor signaling pathway jre05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:jre00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     109010441    04148 Efferocytosis     109010441  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     109010441  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     109010441  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:jre04131]     109010441   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:jre04147]     109010441    04031 GTP-binding proteins [BR:jre04031]     109010441 Membrane trafficking [BR:jre04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     109010441  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     109010441   Macropinocytosis    Ras GTPases     109010441  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     109010441 Exosome [BR:jre04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109010441   Exosomal proteins of other body fluids (saliva and urine)    109010441   Exosomal proteins of colorectal cancer cells    109010441   Exosomal proteins of bladder cancer cells    109010441 GTP-binding proteins [BR:jre04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     109010441 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU AAA_7 Motif Other DBs NCBI-GeneID:  109010441 NCBI-ProteinID:  XP_018846825 UniProt:  A0A2I4GSF1 A0A833U252 LinkDB All DBs Position 11:complement(28390843..28394364) Genome browser AA seq 197 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL DLRDDKQFFIDHPGAVPIATPQGEELRKLIGAPAYIECSSKTQQNVKAVFDAAIKVVLQP PKQKKKKRKAQKACSIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagtgcgtctaggttcattaagtgcgtcaccgtcggtgacggcgccgtcggtaaaacc tgtatgctgatatcctacacgagcaatacattccctacggactatgtgccgactgttttt gacaatttcagtgctaatgttgtcgtggatggaagcactgttaacctagggttatgggat actgctggtcaggaggattacaatagattaaggcccttgagctatcgaggcgcagacgtc tttatacttgctttctctctcataagcaaggctagctatgaaaatgttgctaagaagtgg attcctgaattaaggcattacgcacctggtgttccaataattcttgttggaacaaaactt gatctacgagatgataagcagttctttatagaccatcctggtgcagtgcccattgctacg cctcagggagaagagcttaggaaactgattggagctcctgcctacatcgagtgtagttca aaaacacagcagaatgtcaaggcagtttttgatgcagccataaaggtcgtgctccagcct ccgaagcaaaagaagaagaagagaaaggcacaaaaggcttgctccatactgtga

DBGET integrated database retrieval system