Juglans regia (English walnut): 109011235 Help Entry 109011235         CDS       T05245                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism jre  Juglans regia (English walnut) Pathway jre03083   Polycomb repressive complex jre04120   Ubiquitin mediated proteolysis jre04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:jre00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     109011235    04120 Ubiquitin mediated proteolysis     109011235   09126 Chromosome    03083 Polycomb repressive complex     109011235  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:jre04131]     109011235    04121 Ubiquitin system [BR:jre04121]     109011235    03036 Chromosome and associated proteins [BR:jre03036]     109011235 Membrane trafficking [BR:jre04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     109011235 Ubiquitin system [BR:jre04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      109011235    Cul7 complex      109011235 Chromosome and associated proteins [BR:jre03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      109011235   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      109011235 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ Motif Other DBs NCBI-GeneID:  109011235 NCBI-ProteinID:  XP_018847894 UniProt:  A0A833UIE0 A0A2I4GVG8 LinkDB All DBs Position 8:7236450..7238693 Genome browser AA seq 157 aa AA seqDB search MSSGRKITLRSSDGETFEVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILSKVIEYC KKHVEAPKAEDRAASLDEDLKTWDAEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVAD MIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE NT seq 474 nt NT seq  +upstreamnt  +downstreamnt atgtcgtcggggaggaagataacgctgagaagctcggacggcgagactttcgaggtggat gaggcggtggcactggagtctcagacgatcaagcacatgatcgaggacgactgcgccgac aatggcataccgctcccgaacgtgaccagcaaaatcctctccaaggtcatagagtactgc aagaaacacgtcgaggcccccaaggccgaggaccgcgccgcctccctggacgaggacctc aagacctgggacgccgagttcgtcaaggtcgaccaggccacccttttcgatcttatcctg gctgcaaactatctgaacatcaagagtttgctggatctgacttgccagacagtggctgac atgatcaagggcaaaacccccgaggaaatccgcaagacattcaacatcaagaatgacttc acaccagaggaagaagaggaggttcgcagggagaaccaatgggcctttgagtaa

DBGET integrated database retrieval system