Juglans regia (English walnut): 109015676 Help Entry 109015676         CDS       T05245                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism jre  Juglans regia (English walnut) Pathway jre03083   Polycomb repressive complex jre04120   Ubiquitin mediated proteolysis jre04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:jre00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     109015676    04120 Ubiquitin mediated proteolysis     109015676   09126 Chromosome    03083 Polycomb repressive complex     109015676  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:jre04131]     109015676    04121 Ubiquitin system [BR:jre04121]     109015676    03036 Chromosome and associated proteins [BR:jre03036]     109015676 Membrane trafficking [BR:jre04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     109015676 Ubiquitin system [BR:jre04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      109015676    Cul7 complex      109015676 Chromosome and associated proteins [BR:jre03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      109015676   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      109015676 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Skp1 BTB Motif Other DBs NCBI-GeneID:  109015676 NCBI-ProteinID:  XP_018853688 UniProt:  A0A2I4EKZ9 A0A833U5W9 LinkDB All DBs Position 8:complement(23668502..23670574) Genome browser AA seq 155 aa AA seqDB search MSSSKKITLKSSDGESFEVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEYC KKHVEPANSEDRTSEDDLKAWDMEFVRVDQATLFDLILAANYLNIKSLLDLTCQTVADMI KGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atgtcgtcgtcgaagaagatcaccctgaagagttccgatggcgagtccttcgaggtcgac gaggccgtggctctcgagtctcagaccatcaagcacatgatcgaggacgattgcgccgac aacggcatccctctccccaacgtgacgagcaagatcttggccaaggtcatcgagtactgc aagaagcacgtcgaaccggccaactctgaggaccgcacctccgaagatgatctcaaggct tgggacatggagttcgtcagggttgaccaggccactctcttcgatctcattctggctgca aactatttgaacatcaaaagcctcctggatctgacatgccagactgtggcggacatgatc aagggaaagaccccagaggagatccgcaagacctttaacatcaagaatgactttacccca gaggaagaggaagaggttcgtcgggagaaccagtgggcatttgaatga

DBGET integrated database retrieval system