KEGG   Juglans regia (English walnut): 109019252
Entry
109019252         CDS       T05245                                 
Name
(RefSeq) aspartate aminotransferase, mitochondrial-like
  KO
K14455  aspartate aminotransferase, mitochondrial [EC:2.6.1.1]
Organism
jre  Juglans regia (English walnut)
Pathway
jre00220  Arginine biosynthesis
jre00250  Alanine, aspartate and glutamate metabolism
jre00270  Cysteine and methionine metabolism
jre00330  Arginine and proline metabolism
jre00350  Tyrosine metabolism
jre00360  Phenylalanine metabolism
jre00400  Phenylalanine, tyrosine and tryptophan biosynthesis
jre00710  Carbon fixation by Calvin cycle
jre00950  Isoquinoline alkaloid biosynthesis
jre00960  Tropane, piperidine and pyridine alkaloid biosynthesis
jre01100  Metabolic pathways
jre01110  Biosynthesis of secondary metabolites
jre01200  Carbon metabolism
jre01210  2-Oxocarboxylic acid metabolism
jre01230  Biosynthesis of amino acids
Module
jre_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
jre_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:jre00001]
 09100 Metabolism
  09102 Energy metabolism
   00710 Carbon fixation by Calvin cycle
    109019252
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    109019252
   00270 Cysteine and methionine metabolism
    109019252
   00220 Arginine biosynthesis
    109019252
   00330 Arginine and proline metabolism
    109019252
   00350 Tyrosine metabolism
    109019252
   00360 Phenylalanine metabolism
    109019252
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    109019252
  09110 Biosynthesis of other secondary metabolites
   00950 Isoquinoline alkaloid biosynthesis
    109019252
   00960 Tropane, piperidine and pyridine alkaloid biosynthesis
    109019252
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:jre01007]
    109019252
Enzymes [BR:jre01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     109019252
Amino acid related enzymes [BR:jre01007]
 Aminotransferase (transaminase)
  Class I
   109019252
SSDB
Motif
Pfam: Aminotran_1_2
Other DBs
NCBI-GeneID: 109019252
NCBI-ProteinID: XP_018857070
UniProt: A0A2I4HLP9
LinkDB
Position
1:complement(29619546..29626358)
AA seq 432 aa
MRAQTQRKMVFRAVMSGRVPRWSSDSGARSMSSWWRSVKPAPKDPILGVTEAFLSDSNPN
KVNVGVGAYRDDNGKPVVLECVREAERRIAGNLNMGYLPMGGGVKMGEETLKLAYGEKSE
FIRDKRIAAVQSLSGTGACRLFADFQKRFHPDSQIHIPVPTWANHHNIWRDAQVPHRTFH
YYHPESRGLDFVALMDDIKNAPNGSFFLLHACAHNPTGVDPSEEQWREISHQFKAKGHFP
FFDMAYQGFASGDPERDAKSIRIFLEDGHLIGIAQSYAKNMGLYGQRVGCLSVLCEDEKQ
AVAVKSQLQLLARPMYSNPPVHGALIVSTILSDPALKKLWLKEVKVMADRIIGMRTALRE
NLEKMGSPLSWEHITNQIGMFCYSGLAPEQVDRLTSEFHIYLTRNGRISMAGVTTGNVGY
LANAIHEVTKSA
NT seq 1299 nt   +upstreamnt  +downstreamnt
atgcgcgcacaaacgcagagaaaaatggtgtttcgggcggtgatgtcaggtcgggtcccg
aggtggagctcagattctggagcgagatcaatgtcgtcttggtggcggagcgtgaagccg
gcaccgaaggatcctatactcggtgttacggaggctttcctttccgattccaatccgaat
aaagtcaatgtcggagttggtgcttatcgtgatgataatggaaaaccggttgttttggaa
tgtgttcgagaagcagagcggaggattgcaggaaacttaaacatggggtatcttcctatg
ggggggggggtgaagatgggggaagaaacactgaaactggcctatggggagaaatctgag
ttcatcagagacaagaggatagcagcagtacagtctctctctgggactggtgcatgcaga
ctttttgcagactttcaaaagcgttttcatcctgattcacaaattcacataccagtccca
acctgggcgaaccaccataacatctggagagatgcccaggtacctcataggaccttccat
tactatcacccagagtcgcgcggtttagatttcgtagcactgatggacgatataaagaat
gctccaaatggttcattcttccttcttcatgcttgtgctcacaatcctacaggagtagat
ccttcagaggagcaatggagagagatctcacaccagttcaaggcaaaaggtcattttccc
ttctttgacatggcgtaccaaggttttgctagcggtgatccagagagagatgcaaagtcc
atcagaatttttcttgaggatggacatctaattggaattgctcaatcatatgcaaaaaat
atgggactctatggccagcgagtaggatgcctaagtgtgctttgtgaagatgaaaaacaa
gccgtggctgtgaaaagtcagttgcagctgctggccagacccatgtatagtaacccgccc
gttcatggtgcactcatagtttcaaccattcttagtgatccagcgttgaagaagttatgg
ctcaaagaagttaaggttatggcagatcgcatcattggaatgcgaacagctctacgagaa
aatcttgaaaagatggggtcacccttatcatgggagcacataactaatcagattggtatg
ttctgctacagtggtttggcgcctgaacaagttgatcgtctgacgagcgaatttcacatc
tacctgactcgaaatggtcgtatcagtatggctggagttactacaggcaacgttggctat
ttggctaatgccatccatgaggtcacaaaatctgcatag

DBGET integrated database retrieval system