Juglans regia (English walnut): 118348264 Help Entry 118348264         CDS       T05245                                  Name (RefSeq) calmodulin-7   KO K02183   calmodulin Organism jre  Juglans regia (English walnut) Pathway jre04016   MAPK signaling pathway - plant jre04070   Phosphatidylinositol signaling system jre04075   Plant hormone signal transduction jre04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:jre00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     118348264    04070 Phosphatidylinositol signaling system     118348264    04075 Plant hormone signal transduction     118348264  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     118348264  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:jre01009]     118348264   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:jre04131]     118348264    03036 Chromosome and associated proteins [BR:jre03036]     118348264   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:jre04147]     118348264 Protein phosphatases and associated proteins [BR:jre01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      118348264 Membrane trafficking [BR:jre04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     118348264 Chromosome and associated proteins [BR:jre03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      118348264 Exosome [BR:jre04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    118348264 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 CFAP251_C EF-hand_FSTL1 EH Allatotropin-like_C EF_EFCAB10_C SPARC_Ca_bdg EF-hand_11 SAPC2_N UPF0154 DUF5580_M Dockerin_1 EFhand_Ca_insen EF-hand_EFHB_C Caleosin FCaBP_EF-hand EF-hand_STIM1 SPEF2_C PA_Ig-like SurA_N_3 DUF6279 MecA_N Motif Other DBs NCBI-GeneID:  118348264 NCBI-ProteinID:  XP_035545423 UniProt:  A0A2I4ETG5 LinkDB All DBs Position 4:complement(12354392..12356693) Genome browser AA seq 149 aa AA seqDB search MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE EVDEMIREADVDGDGQINYEEFVKVMMAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcggaccaactcaccgacgaccagatctctgagtttaaggaggccttcagcttgttc gacaaggatggagacggttgcatcactaccaaggagctcgggactgttatgaggtcactg ggccagaacccaactgaagcagagctccaggacatgatcaatgaggttgatgccgatggc aatggaaccattgacttccctgagttcctaaacctcatggccaggaagatgaaagacacc gactcggaggaggagcttaaagaggcattccgggtttttgacaaggatcagaatgggttc atctctgctgctgagctgcgccatgtgatgaccaatcttggagagaagctcaccgacgaa gaagtggatgagatgatcagggaggctgatgttgatggtgatggccagataaactacgag gagtttgtcaaggtgatgatggctaagtaa

DBGET integrated database retrieval system