Janthinobacterium rivuli: P9875_20490 Help Entry P9875_20490       CDS       T09016                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism jri  Janthinobacterium rivuli Pathway jri01100   Metabolic pathways jri01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:jri00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     P9875_20490 (acpP)    00074 Mycolic acid biosynthesis     P9875_20490 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     P9875_20490 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Ribosomal_L50 DUF5783 DUF1493 Motif Other DBs NCBI-ProteinID:  WFR78070 LinkDB All DBs Position complement(4504924..4505163) Genome browser AA seq 79 aa AA seqDB search MSDIEQRVKKIVAEQLGVAEADIKIESSFVDDLGADSLDTVELVMALEDEFEMEIPDEQA EKITTVQQAIDYATAHVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgtcggatatcgaacaacgcgttaagaaaatcgtcgctgagcaactgggcgttgcagaa gcagacatcaaaatcgaatcctccttcgtcgacgatctcggcgccgattccctggacacc gtggaactggtcatggccctggaagacgaattcgaaatggaaatccctgacgaacaagct gaaaaaatcaccaccgtgcaacaggcgatcgactacgccaccgcacacgtcaaggcctaa

DBGET integrated database retrieval system