KEGG   Janthinobacterium svalbardensis: CNX70_02630
Entry
CNX70_02630       CDS       T05119                                 
Symbol
petA
Name
(GenBank) ubiquinol-cytochrome c reductase iron-sulfur subunit
  KO
K00411  ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:7.1.1.8]
Organism
jsv  Janthinobacterium svalbardensis
Pathway
jsv00190  Oxidative phosphorylation
jsv01100  Metabolic pathways
jsv02020  Two-component system
Module
jsv_M00151  Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:jsv00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CNX70_02630 (petA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CNX70_02630 (petA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04148 Efferocytosis
    CNX70_02630 (petA)
Enzymes [BR:jsv01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.8  quinol---cytochrome-c reductase
     CNX70_02630 (petA)
SSDB
Motif
Pfam: Rieske UCR_Fe-S_N
Other DBs
NCBI-ProteinID: ATD59206
UniProt: A0A290WRE9
LinkDB
Position
complement(610287..610895)
AA seq 202 aa
MSNEKQVDSGRRGLLVATCAAGSVVGLATAGALVSTFQPSERAKAAGAPVEVDITTLQPG
EMRTVEWRGKPVWILKRTPEMIASLKQTDGKVADAKSQRNPDEFTPPYCMNEARSIKPEI
LVAVGICTHLGCSPSSKFTPGPQPSLPDDWEGGFLCPCHGSTFDMAGRVFKNKPAPDNLQ
VPRHMYLSDTKLLIGKDEKGEA
NT seq 609 nt   +upstreamnt  +downstreamnt
atgagtaacgaaaagcaggtcgattcaggccgtcgcggcttgctcgtcgccacgtgcgcg
gcgggcagtgtagttggattggcaaccgcgggagccttggtaagcaccttccagccgtcg
gagcgcgcgaaagcggctggcgcgccggtcgaagtagacatcaccaccttgcaacccggc
gaaatgcgcactgtcgaatggcgcggcaagccggtctggattctgaaacgcacgccggaa
atgatcgcgtcgctcaaacaaaccgatggcaaggtcgccgatgccaagtcccaacgcaac
cccgacgaatttacgccaccgtattgcatgaacgaggcgcgctcgatcaagcctgaaatt
ctcgtcgccgtcggcatctgcacccacctgggctgctccccttcctcgaaatttaccccc
ggcccgcaaccgtcgctgcccgatgactgggaaggcggcttcctgtgcccttgccacggc
tccaccttcgacatggcaggccgcgtgttcaagaacaagccggcgccggacaacctgcaa
gtgccgcgccatatgtacctgagcgacaccaaattgctgataggtaaagacgagaaaggc
gaggcttga

DBGET integrated database retrieval system