Janthinobacterium svalbardensis: CNX70_05640 Help Entry CNX70_05640       CDS       T05119                                  Symbol ftsL Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism jsv  Janthinobacterium svalbardensis Brite KEGG Orthology (KO) [BR:jsv00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:jsv03036]     CNX70_05640 (ftsL) Chromosome and associated proteins [BR:jsv03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     CNX70_05640 (ftsL) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FtsL DivIC Motif Other DBs NCBI-ProteinID:  ATD59725 UniProt:  A0A290WS64 LinkDB All DBs Position 1272075..1272344 Genome browser AA seq 89 aa AA seqDB search MTGKLCVVLSALLVCCGLSLVNAQYQSRHLLIDLERAQALSRQLDIDWAQLQLDQSTLGK HERIESIARRDLSMTPLTAARTQYLTEGE NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgactggcaagctgtgtgtcgtgctgtcggccctgctggtgtgctgcggcctgtcgctg gtgaacgcgcagtatcagtcgcgccacctgttgatcgacctggagcgcgcgcaagcgttg tcgcgccagctcgacatcgactgggcgcagctgcagctggaccagtccactttgggcaag catgaacgcattgaatcgatcgcacggcgcgacctgagcatgacgccattgacggcggca cgtacgcaatacctgacggagggcgagtaa

DBGET integrated database retrieval system