KEGG   Janthinobacterium svalbardensis: CNX70_20975
Entry
CNX70_20975       CDS       T05119                                 
Symbol
ilvB
Name
(GenBank) acetolactate synthase, large subunit, biosynthetic type
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
jsv  Janthinobacterium svalbardensis
Pathway
jsv00290  Valine, leucine and isoleucine biosynthesis
jsv00650  Butanoate metabolism
jsv00660  C5-Branched dibasic acid metabolism
jsv00770  Pantothenate and CoA biosynthesis
jsv01100  Metabolic pathways
jsv01110  Biosynthesis of secondary metabolites
jsv01210  2-Oxocarboxylic acid metabolism
jsv01230  Biosynthesis of amino acids
Module
jsv_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
jsv_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:jsv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CNX70_20975 (ilvB)
   00660 C5-Branched dibasic acid metabolism
    CNX70_20975 (ilvB)
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    CNX70_20975 (ilvB)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    CNX70_20975 (ilvB)
Enzymes [BR:jsv01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     CNX70_20975 (ilvB)
SSDB
Motif
Pfam: TPP_enzyme_C TPP_enzyme_M TPP_enzyme_N POR_N GIL1_IRKI_C
Other DBs
NCBI-ProteinID: ATD62342
UniProt: A0A290WZL7
LinkDB
Position
complement(4734104..4735834)
AA seq 576 aa
MNTEAAAGPITGAEIVVRCLAEEGVEHVFGYPGGAVLYIYDAIFQQNKFQHILVRHEQAA
IHAADAYSRSSNKVGVAIVTSGPGVTNAVTGLSTAYMDSIPMVVISGQVPSHAIGQDAFQ
ECDTVGITRPVVKHNFLVKDVKDLAATIKKAFFIARTGRPGPVLVDIPKDISMHKCHFDY
PKEVEMRSYRPVDKGHSGQIRKAVQLLLQAERPMIYTGGGVILANAAPELNKLVDRLGFP
CTNTLMGLGGYRASSEQYVGMPGMHGTYEANMAMQNCDVLIAIGARFDDRVIGNPKHFAS
HPRKIIHVDIDPSSISKRVKVDIPIVGNVKDVLIEFLAQLDAAEAKPNVNALSNWWKQIA
EWRGRECLKYPTSDLVIKPQSVVEKVFQLTKGDAFITSDVGQHQMWAAQYYGFDKPRRWI
NSGGLGTMGVGLPYAMGVQMANPDATVACITGEGSIQMCIQELATCKQYHLTPKIIMLNN
RFLGMVRQWQEIDYGSRYSESYMDSLPDFEKLAEAYGHVGMKIEKPGDVDGALKEAFAMK
DRLVFMNFITDQSENVWPMVKAGKGLSEMMLGSEDL
NT seq 1731 nt   +upstreamnt  +downstreamnt
atgaataccgaagcagcagcaggaccaattaccggcgcagaaattgtcgtgcgctgtctg
gctgaagagggcgtcgagcacgtctttggatacccgggcggagccgtactctacatctac
gacgccatcttccagcaaaacaaattccagcatatcctggtacgccacgagcaggccgcg
atccacgccgccgatgcctattcgcgcagctcgaacaaagtcggtgtcgccatcgtcacg
tccggtccgggtgtcacgaatgccgtcacgggcctgtcgaccgcgtacatggactcgatt
cccatggtggtgatctccggccaggtgccgagccacgccatcggccaggatgcgttccag
gaatgcgacacggtcggcatcacccgccccgtggtcaagcacaacttcctcgtcaaggac
gtcaaggacctggcagcgacgatcaagaaagctttcttcatcgcccgtaccggccgtccg
ggacccgtgctggtcgatatccccaaggatatcagcatgcacaaatgccatttcgactat
ccgaaggaagtcgagatgcgttcctaccgtcccgtcgacaagggccattcgggccagatc
cgcaaggccgtgcagctgttgctgcaagccgaacgcccgatgatctacacgggcggcggc
gtgatcctggcgaatgcggctcccgagctgaacaagctggtcgaccgcctgggtttccca
tgcaccaacaccttgatgggcctgggcggctaccgcgcatcgagtgagcagtatgtcggc
atgcccggcatgcacggcacctatgaagcgaacatggcgatgcagaattgcgacgtgctg
atcgccatcggcgcccgtttcgatgaccgcgtgatcggcaacccgaaacatttcgcctcg
catccgcgcaagatcatccacgtggacatcgatccatcgtcgatttccaagcgcgtcaag
gtcgatatccccatcgtcggcaacgtcaaggacgtgctgatcgagttcctcgcgcaactc
gacgcggccgaagccaagccgaacgtcaatgcattgagcaactggtggaagcagatcgcc
gaatggcgtggccgcgaatgcctgaaatatccgacttccgacctggtcatcaagccgcaa
tcggtggtggaaaaagtcttccagctcaccaagggcgatgccttcatcacctccgacgtg
ggccagcaccagatgtgggcggcgcaatactatggtttcgacaagccgcgccgctggatc
aattccggcggcctgggcaccatgggtgtcggcttgccgtacgccatgggcgtgcagatg
gccaacccggacgccaccgttgcttgtattaccggcgaaggctcgatccagatgtgcatc
caggaacttgccacgtgcaagcagtatcacctgacgccgaagatcatcatgctcaacaac
cgtttcctcggcatggtgcgccagtggcaggaaatcgattacggttcgcgctattccgag
tcgtacatggattcgctgcctgacttcgaaaagctggctgaagcatacggccacgtgggc
atgaaaattgaaaagccgggcgacgtcgacggcgccctgaaagaggcgtttgcgatgaaa
gacaggctggtattcatgaacttcattaccgaccagtccgaaaacgtgtggccaatggtg
aaagccggcaagggcctgtccgaaatgatgctcggttcggaggatctctaa

DBGET integrated database retrieval system