Janthinobacterium svalbardensis: CNX70_20975
Help
Entry
CNX70_20975 CDS
T05119
Symbol
ilvB
Name
(GenBank) acetolactate synthase, large subunit, biosynthetic type
KO
K01652
acetolactate synthase I/II/III large subunit [EC:
2.2.1.6
]
Organism
jsv
Janthinobacterium svalbardensis
Pathway
jsv00290
Valine, leucine and isoleucine biosynthesis
jsv00650
Butanoate metabolism
jsv00660
C5-Branched dibasic acid metabolism
jsv00770
Pantothenate and CoA biosynthesis
jsv01100
Metabolic pathways
jsv01110
Biosynthesis of secondary metabolites
jsv01210
2-Oxocarboxylic acid metabolism
jsv01230
Biosynthesis of amino acids
Module
jsv_M00019
Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
jsv_M00570
Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:
jsv00001
]
09100 Metabolism
09101 Carbohydrate metabolism
00650 Butanoate metabolism
CNX70_20975 (ilvB)
00660 C5-Branched dibasic acid metabolism
CNX70_20975 (ilvB)
09105 Amino acid metabolism
00290 Valine, leucine and isoleucine biosynthesis
CNX70_20975 (ilvB)
09108 Metabolism of cofactors and vitamins
00770 Pantothenate and CoA biosynthesis
CNX70_20975 (ilvB)
Enzymes [BR:
jsv01000
]
2. Transferases
2.2 Transferring aldehyde or ketonic groups
2.2.1 Transketolases and transaldolases
2.2.1.6 acetolactate synthase
CNX70_20975 (ilvB)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
TPP_enzyme_C
TPP_enzyme_M
TPP_enzyme_N
POR_N
GIL1_IRKI_C
Motif
Other DBs
NCBI-ProteinID:
ATD62342
UniProt:
A0A290WZL7
LinkDB
All DBs
Position
complement(4734104..4735834)
Genome browser
AA seq
576 aa
AA seq
DB search
MNTEAAAGPITGAEIVVRCLAEEGVEHVFGYPGGAVLYIYDAIFQQNKFQHILVRHEQAA
IHAADAYSRSSNKVGVAIVTSGPGVTNAVTGLSTAYMDSIPMVVISGQVPSHAIGQDAFQ
ECDTVGITRPVVKHNFLVKDVKDLAATIKKAFFIARTGRPGPVLVDIPKDISMHKCHFDY
PKEVEMRSYRPVDKGHSGQIRKAVQLLLQAERPMIYTGGGVILANAAPELNKLVDRLGFP
CTNTLMGLGGYRASSEQYVGMPGMHGTYEANMAMQNCDVLIAIGARFDDRVIGNPKHFAS
HPRKIIHVDIDPSSISKRVKVDIPIVGNVKDVLIEFLAQLDAAEAKPNVNALSNWWKQIA
EWRGRECLKYPTSDLVIKPQSVVEKVFQLTKGDAFITSDVGQHQMWAAQYYGFDKPRRWI
NSGGLGTMGVGLPYAMGVQMANPDATVACITGEGSIQMCIQELATCKQYHLTPKIIMLNN
RFLGMVRQWQEIDYGSRYSESYMDSLPDFEKLAEAYGHVGMKIEKPGDVDGALKEAFAMK
DRLVFMNFITDQSENVWPMVKAGKGLSEMMLGSEDL
NT seq
1731 nt
NT seq
+upstream
nt +downstream
nt
atgaataccgaagcagcagcaggaccaattaccggcgcagaaattgtcgtgcgctgtctg
gctgaagagggcgtcgagcacgtctttggatacccgggcggagccgtactctacatctac
gacgccatcttccagcaaaacaaattccagcatatcctggtacgccacgagcaggccgcg
atccacgccgccgatgcctattcgcgcagctcgaacaaagtcggtgtcgccatcgtcacg
tccggtccgggtgtcacgaatgccgtcacgggcctgtcgaccgcgtacatggactcgatt
cccatggtggtgatctccggccaggtgccgagccacgccatcggccaggatgcgttccag
gaatgcgacacggtcggcatcacccgccccgtggtcaagcacaacttcctcgtcaaggac
gtcaaggacctggcagcgacgatcaagaaagctttcttcatcgcccgtaccggccgtccg
ggacccgtgctggtcgatatccccaaggatatcagcatgcacaaatgccatttcgactat
ccgaaggaagtcgagatgcgttcctaccgtcccgtcgacaagggccattcgggccagatc
cgcaaggccgtgcagctgttgctgcaagccgaacgcccgatgatctacacgggcggcggc
gtgatcctggcgaatgcggctcccgagctgaacaagctggtcgaccgcctgggtttccca
tgcaccaacaccttgatgggcctgggcggctaccgcgcatcgagtgagcagtatgtcggc
atgcccggcatgcacggcacctatgaagcgaacatggcgatgcagaattgcgacgtgctg
atcgccatcggcgcccgtttcgatgaccgcgtgatcggcaacccgaaacatttcgcctcg
catccgcgcaagatcatccacgtggacatcgatccatcgtcgatttccaagcgcgtcaag
gtcgatatccccatcgtcggcaacgtcaaggacgtgctgatcgagttcctcgcgcaactc
gacgcggccgaagccaagccgaacgtcaatgcattgagcaactggtggaagcagatcgcc
gaatggcgtggccgcgaatgcctgaaatatccgacttccgacctggtcatcaagccgcaa
tcggtggtggaaaaagtcttccagctcaccaagggcgatgccttcatcacctccgacgtg
ggccagcaccagatgtgggcggcgcaatactatggtttcgacaagccgcgccgctggatc
aattccggcggcctgggcaccatgggtgtcggcttgccgtacgccatgggcgtgcagatg
gccaacccggacgccaccgttgcttgtattaccggcgaaggctcgatccagatgtgcatc
caggaacttgccacgtgcaagcagtatcacctgacgccgaagatcatcatgctcaacaac
cgtttcctcggcatggtgcgccagtggcaggaaatcgattacggttcgcgctattccgag
tcgtacatggattcgctgcctgacttcgaaaagctggctgaagcatacggccacgtgggc
atgaaaattgaaaagccgggcgacgtcgacggcgccctgaaagaggcgtttgcgatgaaa
gacaggctggtattcatgaacttcattaccgaccagtccgaaaacgtgtggccaatggtg
aaagccggcaagggcctgtccgaaatgatgctcggttcggaggatctctaa
DBGET
integrated database retrieval system