KEGG   Janthinobacterium svalbardensis: CNX70_26315
Entry
CNX70_26315       CDS       T05119                                 
Name
(GenBank) hypothetical protein
  KO
K02172  bla regulator protein blaR1
Organism
jsv  Janthinobacterium svalbardensis
Pathway
jsv01501  beta-Lactam resistance
Module
jsv_M00627  beta-Lactam resistance, Bla system
Brite
KEGG Orthology (KO) [BR:jsv00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    CNX70_26315
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:jsv01002]
    CNX70_26315
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:jsv01504]
    CNX70_26315
Peptidases and inhibitors [BR:jsv01002]
 Metallo peptidases
  Family M56
   CNX70_26315
Antimicrobial resistance genes [BR:jsv01504]
 Gene sets
  beta-Lactam resistance modules
   beta-Lactam resistance, Bla system [MD:M00627]
    CNX70_26315
SSDB
Motif
Pfam: Peptidase_M56
Other DBs
NCBI-ProteinID: ATD63276
UniProt: A0A290X323
LinkDB
Position
5910982..5911728
AA seq 248 aa
MPAMLAASMALALLLSAAAWRAERLLQRRGRTTRWLWLAAIAASVIVPLAWLPGVLAVMP
ATQSQLKLGWFVLSSGMLMLLVLRSAWLLSHQRRWQKTTLLGTPVYLSGGIGPCVAGLLR
PRIVMPVWLQLIPPRQQALLLAHAQCRLAARDPQLLALAYALIVLMPWNLPLWWQLHRLR
FAIEVDCDARMLAHGHALRDYATVLRRHGQYYSGLTGAAPIVLGDPRALRRRRHLMARFS
GKQAANLL
NT seq 747 nt   +upstreamnt  +downstreamnt
gtgccggccatgctggctgccagcatggcgctggcgctgctgttgagcgccgccgcctgg
cgcgccgagcgcctgctgcagcggcgcgggcgcacgacgcgctggctgtggctggcggcc
atcgcagcctccgtcatcgtgccgctggcgtggctgcccggcgtgctggcggtcatgcct
gcgacacaatcgcagctgaaactgggctggtttgtcttatcaagcggcatgctgatgctg
ttggtgctgcgcagcgcctggctgctgtcgcaccagcgccgctggcaaaaaaccaccttg
ctgggtacgcccgtgtacttgagcggcggcatcggcccttgcgtggcggggctgctgcgg
ccgcgcatcgtgatgcccgtctggctgcaactgattccaccccggcagcaggcgctgctg
ctggcgcacgcacaatgccggctggccgcgcgcgacccgcagttgctggccctggcctac
gccttgatcgtgctcatgccctggaacctgcccctgtggtggcagctgcaccggctacgc
tttgccatcgaagtcgattgcgacgcgcgcatgctggcgcacggccacgcgctgcgcgac
tatgccacggtgctgcgtcggcacggccagtattattcgggcttgacgggcgccgcgccc
atcgtgctgggcgacccgcgcgcgctgcgccggcgccgccatctgatggccagatttagc
gggaagcaggcagcgaacttgctatag

DBGET integrated database retrieval system