Janibacter indicus: ASJ30_01540 Help Entry ASJ30_01540       CDS       T04569                                  Name (GenBank) mannose-6-phosphate isomerase   KO K01809   mannose-6-phosphate isomerase [EC:5.3.1.8] Organism jte  Janibacter indicus Pathway jte00051   Fructose and mannose metabolism jte00520   Amino sugar and nucleotide sugar metabolism jte01100   Metabolic pathways jte01110   Biosynthesis of secondary metabolites jte01240   Biosynthesis of cofactors jte01250   Biosynthesis of nucleotide sugars Module jte_M01000   GDP-Man biosynthesis, Fru-6P => GDP-Man Brite KEGG Orthology (KO) [BR:jte00001]  09100 Metabolism   09101 Carbohydrate metabolism    00051 Fructose and mannose metabolism     ASJ30_01540   09107 Glycan biosynthesis and metabolism    00520 Amino sugar and nucleotide sugar metabolism     ASJ30_01540 Enzymes [BR:jte01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.1  Interconverting aldoses and ketoses, and related compounds     5.3.1.8  mannose-6-phosphate isomerase      ASJ30_01540 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MannoseP_isomer Cupin_2 AraC_binding EutQ CENP-C_C MPI_cupin_dom Motif Other DBs NCBI-ProteinID:  APH00373 UniProt:  A0A1L3MDF4 LinkDB All DBs Position 311005..311370 Genome browser AA seq 121 aa AA seqDB search MTDLPDPREDMFVSERPWGSFQQFTFNEPTTVKVITVEPGQRLSLQTHALRAEFWQVLDG PIDVTVGERTWSAQPGEQVWIPVGTRHRMGNSAEVPGRVLEVGYGEFDEADIVRLEDDYQ R NT seq 366 nt NT seq  +upstreamnt  +downstreamnt gtgaccgacctgccggacccgcgcgaggacatgttcgtgtccgagcgtccgtggggcagc ttccagcagttcaccttcaacgagccgacgacggtcaaggtcatcaccgtcgagccgggg cagcggctgtcgctgcagacccacgccctgcgggcggagttctggcaggtcctcgacggc ccgatcgacgtcaccgtcggcgagcgcacgtggagcgcgcagcccggcgagcaggtctgg atccccgtcgggacccggcaccgcatgggcaacagcgccgaggtccccgggcgggtcctc gaggtcggctacggcgagttcgacgaggccgacatcgtgcggctcgaggacgactaccag cgttga

DBGET integrated database retrieval system