Jatrophihabitans telluris: M6D93_13540 Help Entry M6D93_13540       CDS       T08151                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism jtl  Jatrophihabitans telluris Pathway jtl01100   Metabolic pathways jtl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:jtl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     M6D93_13540    00074 Mycolic acid biosynthesis     M6D93_13540   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     M6D93_13540 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  UQX90313 LinkDB All DBs Position 2914697..2914912 Genome browser AA seq 71 aa AA seqDB search MAEILNEVADVAPEDVTVEKSFTDDLDVDSLSMVEVAMAAEEKFGVKIPDEELPKLKTVG DAVSYIQANPA NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atggccgagatcctgaacgaggtggccgatgtggcgcccgaggacgtgacggtggagaag tcgttcaccgacgacctggacgtcgactcgctgtccatggtcgaggtggccatggccgcc gaggagaagttcggcgtcaagatccccgacgaggaactgccgaagctcaagaccgtcggc gacgccgtgtcctacatccaggccaacccggcctga

DBGET integrated database retrieval system