KEGG   Jatrophihabitans telluris: M6D93_15990
Entry
M6D93_15990       CDS       T08151                                 
Name
(GenBank) acetyl/propionyl/methylcrotonyl-CoA carboxylase subunit alpha
  KO
K11263  acetyl-CoA/propionyl-CoA/long-chain acyl-CoA carboxylase, biotin carboxylase, biotin carboxyl carrier protein [EC:6.4.1.2 6.4.1.3 6.4.1.- 6.3.4.14]
Organism
jtl  Jatrophihabitans telluris
Pathway
jtl00061  Fatty acid biosynthesis
jtl00074  Mycolic acid biosynthesis
jtl00280  Valine, leucine and isoleucine degradation
jtl00620  Pyruvate metabolism
jtl00630  Glyoxylate and dicarboxylate metabolism
jtl00640  Propanoate metabolism
jtl01100  Metabolic pathways
jtl01110  Biosynthesis of secondary metabolites
jtl01120  Microbial metabolism in diverse environments
jtl01200  Carbon metabolism
jtl01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:jtl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    M6D93_15990
   00630 Glyoxylate and dicarboxylate metabolism
    M6D93_15990
   00640 Propanoate metabolism
    M6D93_15990
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    M6D93_15990
   00074 Mycolic acid biosynthesis
    M6D93_15990
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    M6D93_15990
Enzymes [BR:jtl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     M6D93_15990
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     M6D93_15990
    6.4.1.3  propionyl-CoA carboxylase
     M6D93_15990
SSDB
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Biotin_lipoyl ATP-grasp Biotin_lipoyl_2 Dala_Dala_lig_C ATP-grasp_3
Other DBs
NCBI-ProteinID: UQX87788
UniProt: A0ABY4QWD6
LinkDB
Position
3475358..3477118
AA seq 586 aa
MQKVLIANRGEIAVRVIRACRDAGLASVAIYAEPDRDALHVRMADEAWALGGNTPGESYL
LIDKVIGAAKESGADAVHPGYGFLSENADFAQAVIDAGLTWIGPSPQAIRDLGDKVTARH
IALRAGAPLVPGTKDPVSGADEVVAFATEHGLPVAIKAAFGGGGRGLKIARTMEEIPELY
DSAVREAVTAFGRGECFVERYLERSRHVEAQVLADQHGNVIVVGTRDCSLQRRNQKLVEE
APAPFLTDEQRDRIHSSAKAICREAGYTGAGTVEYLVGNDGVISFLEVNTRLQVEHPVTE
ETSGSDLVREQFRIADGHALRRLSDPEPRGHAFEFRINGEDPGRNFLPAPGVVTTYREPS
GPGVRVDSGIEGDSVVGGAFDSLLAKLIVWGESREQALERARRALDEYVVDGMATALPFH
RAVVRDPAFAPDGDEPFTVFTRWIETEFVNEIPAFTAAAAAGGTEAERQTIVVEVGGKRL
EVCLPAGLGVASAPASGKKAAPKRSSGPKSSAAVSGDALTAPMQGTIVKVAVSDGDTVAA
GDLVVVLEAMKMEQPINAHKAGTITGLSAEAGAVVTSGSVLCEIKQ
NT seq 1761 nt   +upstreamnt  +downstreamnt
atgcagaaggtgctcatcgccaaccggggcgagatcgcggtgcgggtcatccgggcatgt
cgggacgccgggttggcgtcggtggcgatctatgccgagcctgaccgcgacgcgctgcac
gttcggatggccgacgaggcctgggcgctggggggcaacacccccggcgagtcctacctg
ctcatcgacaaggtgattggtgcggccaaggagtccggcgccgacgcggtgcaccccggc
tacggattcctgtcggagaacgcggacttcgcccaggctgtcatcgatgcggggctgacc
tggatcggcccgtctccgcaggccattcgcgacctcggtgacaaggtgaccgcccggcac
atcgcgctgcgcgcgggcgcgcccttggttcccgggacgaaggatcccgtgtcgggcgcg
gatgaggtggtcgcgttcgcgaccgagcacggtctgcccgtggccatcaaggccgccttc
ggcggcggtggccgcggcctgaagatcgcccgcacgatggaggagatccccgagctctac
gacagcgccgtgcgcgaggccgtcaccgccttcggccggggcgaatgcttcgtcgagcgc
tacctggagcgctcccgccacgtcgaggcgcaggtgctggccgatcagcacggcaacgtc
atcgtcgtcggcacccgggactgctcgctgcaacgccgtaaccagaaactcgtcgaggag
gcgcccgcgccgtttctcaccgacgagcagcgcgatcgcatccacagctcggccaaggcc
atctgccgcgaggccggttacaccggcgccgggacggttgagtatctggtcggcaacgac
ggggtgatcagcttcctggaggtcaacactcgtctgcaggtcgagcatccggttactgag
gagacctcgggatcggacttggtgcgggagcagttccgcatcgccgacggacacgcgctg
cgccggctgagcgacccggagccgcgcgggcacgcgttcgagttccggatcaacggcgag
gacccgggccgcaacttcctgccggcgcccggtgtcgtcaccacctaccgggaaccctcc
ggccctggtgttcgggtggactccggcatcgagggcgactcggtggtcgggggcgccttc
gactccctgctggccaagctcatcgtgtggggcgagagccgcgaacaggcgctggagcgc
gcgcgacgagcgctcgacgagtacgtcgtggacggtatggccactgcgctgcccttccac
cgcgcggtcgtccgtgacccggccttcgcaccagacggggacgaacccttcactgtgttc
acccgctggatcgagacggagttcgtcaacgagattcccgcgttcacggcagccgccgcg
gcgggcgggaccgaggccgaacggcagaccatcgtcgtcgaggtcggcggtaagcggctg
gaggtctgtctgccggccggtctgggcgtggccagcgctccggcctccggcaagaaggcg
gcgccgaagcgctcgtccggaccgaagtcgtcggccgcggtttccggcgacgctctcacg
gccccgatgcagggcacgatcgtgaaggtggcggtgtccgacggcgacaccgtggccgcc
ggtgacctggtggtcgtcctcgaggcgatgaagatggaacagcccatcaacgcccacaag
gccgggacgataaccgggttgagcgccgaggccggcgccgtcgtgacctccggatcggtg
ctctgcgaaatcaagcagtag

DBGET integrated database retrieval system