Kazachstania africana: KAFR_0A07800 Help Entry KAFR_0A07800      CDS       T02487                                  Symbol KAFR0A07800 Name (RefSeq) hypothetical protein   KO K00730   dolichyl-diphosphooligosaccharide---protein glycosyltransferase subunit 4 Organism kaf  Kazachstania africana Pathway kaf00510   N-Glycan biosynthesis kaf00513   Various types of N-glycan biosynthesis kaf01100   Metabolic pathways kaf04141   Protein processing in endoplasmic reticulum Module kaf_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:kaf00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     KAFR_0A07800 (KAFR0A07800)    00513 Various types of N-glycan biosynthesis     KAFR_0A07800 (KAFR0A07800)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     KAFR_0A07800 (KAFR0A07800) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost4 SK_channel Motif Other DBs NCBI-GeneID:  13886004 NCBI-ProteinID:  XP_003955349 UniProt:  H2APB4 LinkDB All DBs Position 1:complement(1566613..1566714) Genome browser AA seq 33 aa AA seqDB search MSDSQLNTLAITSGLIMMTLIVVYHTISSSNKK NT seq 102 nt NT seq  +upstreamnt  +downstreamnt atgtccgactctcaattgaatactttagcgattacttcaggtttgataatgatgactttg attgttgtgtaccataccatcagttcatccaataagaaatag

DBGET integrated database retrieval system