Kaistia sp. 32K: K32_05850
Help
Entry
K32_05850 CDS
T06998
Name
(GenBank) dehydrogenase
Organism
kai
Kaistia sp. 32K
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
2-Hacid_dh_C
2-Hacid_dh
NAD_binding_2
NAD_binding_7
Motif
Other DBs
NCBI-ProteinID:
BCP51968
LinkDB
All DBs
Position
667157..668194
Genome browser
AA seq
345 aa
AA seq
DB search
MRILKANWYPPENPELFEMFGSKADFDIDPTPADPAYRLDRARSAAADAVINCSATLLLP
AELDDFEKVKIVVREGVGYDNLDLEGWGARGVPVCNVPDYGTTEVADHALALMLALTRGT
ETYDRLLNADPEHGWNFARAPLVRRLRGATFGVVGLGRIGLAAARRAAAFDMRVVFFDPH
LSNGVELATGYERVHSLKELMAISDILSVHAPLSAETNGFLDAAAFAAAKPGLILINTAR
GPIVDLDALLAALKDGRVAGAGLDVLPKEPADRSHPLIAAWAAREPWIDGRLALSPHAAF
YSPASMKDMQRKAVECILAFLNEGRLTNCVNREFLVTPAKVRKAS
NT seq
1038 nt
NT seq
+upstream
nt +downstream
nt
atgcgcattctgaaagccaactggtatccgcccgaaaatccggagctcttcgagatgttc
ggatcgaaggcagatttcgacatcgacccgacgcccgccgatcccgcctatcggctcgat
cgcgcccgctcggccgccgccgacgccgtcatcaactgctcggcgacgcttctgttgccg
gccgaactcgacgacttcgagaaggtgaagatcgtcgtgcgcgagggcgtcggctacgac
aatctcgaccttgagggctggggcgcgcgcggcgtgccggtctgcaacgtgccggattac
ggcacgaccgaggtcgccgaccacgcgctcgcgctgatgctggcgctgacgcgcggcacc
gaaacctatgaccgtctgctgaacgccgacccggagcacggctggaactttgcccgcgcg
ccgctggtgcgacggctccgcggcgccaccttcggcgtcgtcggcctcggccgcatcggg
ctcgccgccgcgcgccgcgccgccgctttcgacatgcgcgtcgtcttcttcgatccgcat
ctctcgaacggcgtcgagctcgccaccggctatgagcgcgtgcacagcctgaaggaattg
atggcgatcagcgacatattgagcgtgcatgcgccgctttcggccgagacgaacggcttt
ctcgacgccgccgccttcgcggccgccaagccggggctgatcctgatcaacacggcgcgc
gggccgatcgtcgatctcgatgcgctcttggcggcgctgaaggacggccgcgtcgccggc
gccgggctcgacgtgctgccgaaggagccggccgatcgttcgcatccgctgatcgccgcc
tgggcggcgcgcgaaccgtggatcgacggccgcctggcgctgtcgccgcacgccgccttc
tacagccccgcctcgatgaaggacatgcagaggaaagccgtcgagtgcatcctcgctttt
ctgaacgagggaaggctgaccaactgcgtcaaccgggagttccttgtgacgccggccaag
gtgcgcaaggcgtcgtag
DBGET
integrated database retrieval system