Kaistia sp. 32K: K32_48670 Help Entry K32_48670         CDS       T06998                                  Symbol acpP_3 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism kai  Kaistia sp. 32K Pathway kai00998   Biosynthesis of various antibiotics kai01100   Metabolic pathways kai01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kai00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     K32_48670 (acpP_3)    00074 Mycolic acid biosynthesis     K32_48670 (acpP_3)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     K32_48670 (acpP_3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 pP_pnuc_2 ACP_SdgA_C DUF1493 Motif Other DBs NCBI-ProteinID:  BCP56250 LinkDB All DBs Position 5235941..5236192 Genome browser AA seq 83 aa AA seqDB search MSKTTEQRVTDIIASFFAVGDVLATDITPDKNLVDDLGADSLDLIEIVMEVEGEFDIEIS DAAAEQVRTVQQAIDLVSRLVGQ NT seq 252 nt NT seq  +upstreamnt  +downstreamnt ttgagcaagaccactgagcagcgcgtcaccgacatcatcgccagcttcttcgccgtgggc gatgtgctggcaaccgacatcacgccggacaagaacctggtcgacgacctgggagccgac agcctcgacctgatcgagatcgtcatggaggtcgagggcgagttcgacatcgagatcagc gacgcggccgccgagcaggtgcgcaccgtccagcaggcaatcgatctggtcagccggctg gttggccagtaa

DBGET integrated database retrieval system