Ketobacter alkanivorans: Kalk_17385 Help Entry Kalk_17385        CDS       T05294                                  Symbol ftsL Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism kak  Ketobacter alkanivorans Brite KEGG Orthology (KO) [BR:kak00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:kak03036]     Kalk_17385 (ftsL) Chromosome and associated proteins [BR:kak03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     Kalk_17385 (ftsL) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL Motif Other DBs NCBI-ProteinID:  AUM15008 UniProt:  A0A2K9LRR5 LinkDB All DBs Position 4060050..4060304 Genome browser AA seq 84 aa AA seqDB search MFVIVALVLVMGSCLAVIYSSFETRRLVATHQRLQLDNNAMQVEWGQLLLEQSTWGSYNR VEQLAGAKLKMRVPSPNEIVMVEP NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgtttgtgattgttgcattggttctggtgatgggttcctgtttggcggtgatttactca agttttgaaacccgccgcctggttgccacccaccaaagattgcagctggataacaacgcc atgcaagtcgaatggggccagttgttgttggaacaaagtacatggggatcctataaccga gttgagcagctggctggtgcaaaactgaaaatgagagttccgtctcccaatgaaattgtg atggtggagccatga

DBGET integrated database retrieval system