Kutzneria albida: KALB_2252 Help Entry KALB_2252         CDS       T03039                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism kal  Kutzneria albida Pathway kal00998   Biosynthesis of various antibiotics kal01100   Metabolic pathways kal01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kal00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KALB_2252    00074 Mycolic acid biosynthesis     KALB_2252   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KALB_2252 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AHH95621 UniProt:  W5W5B2 LinkDB All DBs Position 2440603..2440878 Genome browser AA seq 91 aa AA seqDB search MTSSVHSQDVREFVLSTLATEMNVPIDRDSLTDDSPIGTSGIDLESLSLVELTLRLERQF EVKIPDSDIEAIGAMTLGQLVDDIVRRRAAA NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaccagctccgtgcacagccaggacgtccgcgagttcgtgctcagcaccctggccacc gagatgaacgtgcccatcgaccgcgactcgctcaccgacgacagccccatcggcaccagc ggcatcgacctggagtcgctgagcctggtcgagctgaccctgcggctggagcgccagttc gaggtgaagatcccggactcggatatcgaggccatcggcgcgatgaccctgggccagctg gtggacgacatcgtgcggcgcagggcggcggcgtga

DBGET integrated database retrieval system