KEGG   Klebsiella africana: LGL98_07525
Entry
LGL98_07525       CDS       T07696                                 
Name
(GenBank) MFS transporter
  KO
K26580  MFS transporter, ACS family, inner membrane transport protein
Organism
kar  Klebsiella africana
Brite
KEGG Orthology (KO) [BR:kar00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kar02000]
    LGL98_07525
Transporters [BR:kar02000]
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Anion:cation symporter (ACS) family [TC:2.A.1.14]
    LGL98_07525
SSDB
Motif
Pfam: MFS_1 Imm21 O-antigen_lig
Other DBs
NCBI-ProteinID: UDD42754
LinkDB
Position
1544740..1546029
AA seq 429 aa
MSNTLLESVVKKNRARLIPFMLALYVLAFLDRSNIGFAKETYQLDTGLSNEAYALGAGIF
FVVYAFLGVPANLLMRKFGARRWIGCTTLLWGVLSAAMAWADTEAKFLLVRTLLGAAEAG
FFPGMIYLTSQWFPQQNRASIMGLFYMGAPLALTLGSPLSGALLEMHGFMGHPGWFWMFV
IEGLLAVAAGAFTFFWLDDSPQHARFLSAAEKQALISELAREEEKKITSRLSDALRNGRV
WQLALIYLTIQVAVYGLIFFLPTQVAALLGTKVGFVASVVTAIPWVAALFGTWLIPRYSD
RTGERRNIAALTLLAAAVGIAVSGLVAPVLAIIALCVAAVGVIAVQPVFWTMPTQLLSGT
ALAAGIGFVNLFGAIGGFLAPIVRVQAETLFASSAAGLLTLAGVAIVGVVIIFSLSLARA
VPQRGSVQH
NT seq 1290 nt   +upstreamnt  +downstreamnt
atgagcaacactctgctggagagcgtggtgaagaaaaaccgcgcccgcttaatccccttt
atgctggccctgtatgtgctggcgtttcttgaccgctccaatattggttttgccaaggag
acgtaccagctcgataccgggctcagcaatgaagcctacgcgctgggggccggtattttc
tttgtggtctatgccttcctcggggtgccggccaatctgctgatgcgcaaatttggcgcc
aggagatggatcggctgcaccacgctgctgtggggcgtgctgtcggcggcgatggcgtgg
gcggacactgaagcgaagtttcttctggtacgtaccctgctgggcgcggccgaggcaggt
ttctttcccggaatgatctacctcacttcgcagtggtttccccagcaaaaccgcgccagc
attatggggctgttttatatgggggcgccgctggccctgacgctgggatcgcctttatcc
ggtgcgctgctggagatgcatggatttatgggccatcccggctggttctggatgtttgtc
attgaaggcctgctcgccgtcgccgcgggagcgttcaccttcttctggctggacgattcc
ccgcagcatgcccgcttcctgagcgctgcagagaaacaggcgctgataagcgagctggcg
cgcgaggaggagaaaaagatcacctctcgcctgtccgatgcgctgcgtaacgggcgggtc
tggcagctggcgctgatttatctgactattcaggtagcggtctatggcctgattttcttc
ctgcccactcaggtcgccgcgctgctgggcaccaaagtcggcttcgttgcctcggtggtg
acggccatcccgtgggtggcagcgctgttcggcacctggcttatccctcgctactccgat
cgcaccggcgagcggcgcaatattgccgccctgacgctgctggcggcggcggtcgggatt
gcagtttccggactggtggcaccggtgctggctatcatcgcgctgtgcgtggcggcggtc
ggggtgattgccgtgcagccggtcttctggacgatgccaacgcagctgctgtccggcacg
gcgctggccgccgggattggctttgttaacctttttggcgccatcggtggttttctggcg
ccgatcgtgcgcgtgcaggccgaaacgttgttcgccagtagcgccgccggactgttaacc
ctggccggcgtcgccattgtcggggtggtcattatcttttcattgagccttgcccgcgcg
gttccccagcgcggcagcgtacagcattga

DBGET integrated database retrieval system