Kluyvera ascorbata: KATP_27760 Help Entry KATP_27760        CDS       T06881                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism kas  Kluyvera ascorbata Pathway kas01100   Metabolic pathways kas01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kas00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KATP_27760 (acpP)    00074 Mycolic acid biosynthesis     KATP_27760 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KATP_27760 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB HLH Motif Other DBs NCBI-ProteinID:  BCA40254 LinkDB All DBs Position complement(2956769..2957005) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaatcatcggcgaacagctgggcgttaagcag gaagaagtgaccaacaatgcttccttcgttgaagacctgggcgcagattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggtcaccaggcgtaa

DBGET integrated database retrieval system