Kitasatospora aureofaciens: B6264_21110 Help Entry B6264_21110       CDS       T05021                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism kau  Kitasatospora aureofaciens Pathway kau03060   Protein export kau03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:kau00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     B6264_21110  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     B6264_21110  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:kau02044]     B6264_21110 Secretion system [BR:kau02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    B6264_21110 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  ARF81071 UniProt:  A0A1E7N5A6 LinkDB All DBs Position 4758336..4758638 Genome browser AA seq 100 aa AA seqDB search MRFSMTAIVVVAVVAIVLFGAKRLPELARSLGQSMRILKSEAKAMRSEDEPDGSAPSARP QVAPQPAARTVQTAPGASATARPVAEPGAGQDAPDGDRPH NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgcgcttctcgatgaccgcgatcgtggtggtcgcagtggttgccatcgtgctgttcggg gccaagcggctgcccgagctggcgcgctcgctggggcagtcgatgcggatcctgaagagc gaggccaaggcgatgcgttcggaggacgagccggacgggagcgcgccgtcggcccggccg caggtcgcgccgcagccggcggccaggaccgtccagaccgctccgggggcctcggccacg gcccgtccggtcgccgagccgggcgccgggcaggatgcgcccgacggcgaccgaccgcac tga

DBGET integrated database retrieval system