Kozakia baliensis: A0U89_02275
Help
Entry
A0U89_02275 CDS
T04547
Name
(GenBank) ubiquinol-cytochrome c reductase iron-sulfur subunit
KO
K00411
ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:
7.1.1.8
]
Organism
kba
Kozakia baliensis
Pathway
kba00190
Oxidative phosphorylation
kba01100
Metabolic pathways
kba02020
Two-component system
kba04148
Efferocytosis
Module
kba_M00151
Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:
kba00001
]
09100 Metabolism
09102 Energy metabolism
00190 Oxidative phosphorylation
A0U89_02275
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
A0U89_02275
09140 Cellular Processes
09141 Transport and catabolism
04148 Efferocytosis
A0U89_02275
Enzymes [BR:
kba01000
]
7. Translocases
7.1 Catalysing the translocation of protons
7.1.1 Linked to oxidoreductase reactions
7.1.1.8 quinol---cytochrome-c reductase
A0U89_02275
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
UCR_Fe-S_N
Rieske
Motif
Other DBs
NCBI-ProteinID:
AOX16141
UniProt:
A0A1D8UR82
LinkDB
All DBs
Position
498185..498841
Genome browser
AA seq
218 aa
AA seq
DB search
MTNESRPSSGQTNSTDIETQPTRRDVLAKTTLGMGCAGACALAYPFLDSLNGTRGEDLGG
DDTVDVDISTLHPGQQIVVTWRGWPVFVQRRTSDMLASLQAPGVTQRLRDPESKIMQQPR
DATNWHRSITPEIGVLVGICTHLGCVPNFNAPNAADHAGNYACPCHGSQFDVAGRAYKEA
PAPYNLPVPPVTMLSETKLKIGVSKGDPGFDIANIQQI
NT seq
657 nt
NT seq
+upstream
nt +downstream
nt
atgacaaacgaaagccgtccttcttccgggcagacaaattcgacggatatagaaacccaa
ccgacacgccgggacgttctggcgaaaaccacgctcggcatgggctgtgccggggcttgc
gctttagcttatccctttctcgatagcttgaacggaacgcgcggcgaggatttgggtggg
gatgacacggtggatgtcgatatctccacgcttcatcctggccagcagatcgtcgtcaca
tggcgcggctggccagttttcgtgcagcgtcgcacgtccgacatgttggcttcgctgcaa
gcgcccggcgtgacgcagagattgcgcgatccggaatcgaaaatcatgcaacaacccagg
gatgccacgaactggcatcgctccatcacgcctgaaatcggcgtgctggtgggaatttgc
acgcatctcggctgtgtgccgaacttcaacgcgccaaacgccgccgatcatgcggggaat
tacgcctgcccttgccatggttcgcaattcgatgtcgcgggccgcgcttataaggaagcg
ccggcgccctataatctgccggttccccccgttaccatgctctccgaaaccaaattgaaa
atcggcgtcagcaagggcgatcctgggttcgacatcgccaacatccagcagatttga
DBGET
integrated database retrieval system