Kozakia baliensis: A0U89_08940 Help Entry A0U89_08940       CDS       T04547                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism kba  Kozakia baliensis Pathway kba01100   Metabolic pathways kba01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kba00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     A0U89_08940    00074 Mycolic acid biosynthesis     A0U89_08940   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     A0U89_08940 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1493 DUF5783 Motif Other DBs NCBI-ProteinID:  AOX17236 UniProt:  A0A1D8UUB8 LinkDB All DBs Position complement(1920973..1921212) Genome browser AA seq 79 aa AA seqDB search MSEIADKVKKIVVEHLGVDESKVTPDASFIDDLGADSLDTVELVMAFEEAFSVEIPEDAA EKISTVKDAIDYIEKQKAA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgaaatcgctgataaggttaagaagatcgtcgttgagcacctcggtgtcgacgag agcaaagtgacgccggatgcgtctttcatcgacgatctgggcgctgacagcctggacacg gtcgagctggtgatggcgttcgaagaagcgttcagcgtcgaaatcccggaagacgcggct gagaaaatctccaccgtcaaggacgcgatcgactacatcgaaaagcagaaagccgcttga

DBGET integrated database retrieval system