KEGG   Kozakia baliensis: A0U89_09355
Entry
A0U89_09355       CDS       T04547                                 
Name
(GenBank) rod shape-determining protein RodA
  KO
K05837  peptidoglycan glycosyltransferase [EC:2.4.99.28]
Organism
kba  Kozakia baliensis
Pathway
kba00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:kba00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A0U89_09355
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:kba01003]
    A0U89_09355
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:kba01011]
    A0U89_09355
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:kba03036]
    A0U89_09355
Enzymes [BR:kba01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.28  peptidoglycan glycosyltransferase
     A0U89_09355
Glycosyltransferases [BR:kba01003]
 Polysaccharide
  Bacterial polysaccharide (excluding LPS)
   A0U89_09355
Peptidoglycan biosynthesis and degradation proteins [BR:kba01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase
   A0U89_09355
Chromosome and associated proteins [BR:kba03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    A0U89_09355
SSDB
Motif
Pfam: FTSW_RODA_SPOVE FixP_N
Other DBs
NCBI-ProteinID: AOX17308
UniProt: A0A1D8UUJ7
LinkDB
Position
complement(2010241..2011395)
AA seq 384 aa
MNWQKRLWRPESSFRLMAKLLQVNWLYVLLICALAGVGYLALYSAGGGSAKPFAGPQAVR
FGFGLLMMVLVALLSPRVLRWLSVPIYLLSITLLGLVLRMGHVGKGAERWISLGGMQFQP
SEFAKIALVLALASWFYRIDPVRMGNPLRLIPPALMVLLPVALVLKEPNLGTGVIIGVIG
ATMFFSAGMRLWQILILVAPIPFLGKFVYAHLHDYQKARIDTFLHPEHDPLGAGYNIIQS
KIALGSGGMWGEGYLRGTQGQLNFLPEKQTDFIFTMIGEEWGYAGAVSVIALLGILVLGG
MLISLRSRNQFGRLLALGISVDFFMYCAVNLSMVMGVIPVGGVPLPLVSYGGSAMLTMMF
GFGLLLSTWVHRNEKDRPTSDVAE
NT seq 1155 nt   +upstreamnt  +downstreamnt
atgaattggcaaaaacgtctttggagaccggaatcgagctttcgcctaatggcgaagctg
cttcaggtgaactggctttacgtattgctgatctgcgccttggctggcgtcggctatctt
gcgctttattcggcgggtggcggctcggccaagccgttcgccgggccgcaagccgtccga
tttggttttggcttgttgatgatggtgctggtggccctgctcagcccacgcgtgctgcgc
tggctttccgtgccgatttatttgctatccatcacgctgctcggattggtgctgcgtatg
gggcatgtcggtaaaggcgcggaacgttggatttcgctcggcggcatgcaatttcagccc
tcggaattcgccaaaatcgcgctcgttctggcgttggcgagttggttctatcggatcgac
ccggtgcgcatgggcaatccgctgcgcctcatcccgccagcgctcatggtgttgctgccg
gtggcgctggttctcaaagagcctaatctcggcacgggcgtcattatcggcgtgatcggc
gcgacgatgtttttctcggccgggatgaggctgtggcagattctgatcctggtcgcgccg
atcccgtttctcggcaagttcgtctacgcccacctgcacgattaccagaaagcgcggatc
gataccttcctgcatcccgagcacgatcctctcggcgcgggatacaatatcatccaatcg
aaaatcgcgctgggttcgggcggtatgtggggcgagggctatctgcgcggtacgcaaggg
caactgaacttcttgccggaaaagcagacggatttcattttcaccatgatcggtgaagag
tggggatatgccggggcggtctctgttatcgcgttgttgggtattctcgttttaggcgga
atgttgatctccttgcgcagccgcaatcaattcggtcggctgttggcgctggggatctcg
gtcgatttcttcatgtattgcgccgtcaatttgtcgatggtcatgggcgtcattcccgtt
ggcggcgtgcctctgccgctggtctcctatggaggatcggccatgctgacgatgatgttc
ggctttggcttgctgctctccacctgggttcatcgcaacgagaaagaccgccctaccagc
gacgttgcggaatga

DBGET integrated database retrieval system