Kozakia baliensis: A0U89_10510
Help
Entry
A0U89_10510 CDS
T04547
Name
(GenBank) oxidoreductase
Organism
kba
Kozakia baliensis
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
GFO_IDH_MocA_C
GFO_IDH_MocA_C3
GFO_IDH_MocA
NAD_binding_3
Sacchrp_dh_NADP
Semialdhyde_dh
F420_oxidored
AAA_33
Motif
Other DBs
NCBI-ProteinID:
AOX17500
UniProt:
A0A1D8UV36
LinkDB
All DBs
Position
complement(2255170..2256237)
Genome browser
AA seq
355 aa
AA seq
DB search
MNEHAPFRVALIGYGFAAKTFHAPLISAERRLKLAHVASRDAPKVHADFPGVKVGSDPLQ
VATAEDVDLIVIASPNDSHAPLARAALKAGKHVVVDKPFTLDLAEARELVALAKVQNRLL
SVFHNRRWDSDFLSVRQIIETGQIGSVAHFESRIDRFRPEVRRRWREGDGPGSGIWFDLG
PHLIDQALQLFGLPERVLASFARQRPGALATDWAHVVLEYGPRRVILHASMLVAGGSPRF
VVHGDKGSLVKHAADQQEAQLLAGVTPGAPGWGEDADPVLLYDGSGTTCSQLAVAGDQRR
FYAGIAAALNGEVPNPVTPLQALAVMSVLDAAIRSAETGVGVVLDLSEQEREAWT
NT seq
1068 nt
NT seq
+upstream
nt +downstream
nt
atgaacgaacatgcgccatttcgggtggctttgatcggctacggctttgcggcgaaaaca
tttcacgcgccgcttatctccgccgagcgccgattgaaactggcgcatgtcgcctcacgc
gatgcgccgaaggttcacgccgattttccgggtgtgaaggtgggttcggacccattacag
gttgcaaccgccgaggatgtggatctgatcgtgattgcatctcccaatgacagccatgcg
cctcttgcgcgtgcggcgttgaaggccggaaagcatgtggtggtggataagcccttcacg
ctcgatttggcggaggcgcgggagttggtcgcgctggcgaaggtgcaaaaccggctttta
tccgtctttcacaatcggcgatgggacagcgattttctaagcgtccggcagattatcgag
acgggacagatcggctcggtcgcgcatttcgaatctcgcatcgaccgttttcgcccggag
gtgcgtcgccgctggcgtgagggcgatggtcctggcagcggaatatggttcgatctcggc
ccgcatctgatcgatcaggctttgcagcttttcgggcttccggagcgggttctggcgtct
ttcgcgcgtcaacgcccgggcgcgttggccacggattgggcgcatgtcgtgctggaatac
ggcccgcgccgggtgattttgcacgcgagcatgttggtcgcgggcggatcgccacggttt
gtggtgcatggcgataagggaagcttggtgaaacatgcggcggatcaacaagaggcgcag
ctactcgcgggagtgaccccaggcgctcccggctggggagaagatgcggacccggtcctt
ctgtatgacgggagtggaacgacctgttcccaactggccgtcgcgggagatcagcgccgg
ttttatgcaggaattgcggcagcgttgaatggagaggtgcccaatccggttacgcctcta
caggccttggcggtgatgtcggtgttggacgcggccatacggtcggccgagaccggcgtg
ggggttgtgctcgatttatcagaacaggagcgtgaagcgtggacgtga
DBGET
integrated database retrieval system