KEGG Orthology (KO) [BR:kbi00001]
09120 Genetic Information Processing
09121 Transcription
03020 RNA polymerase
30211837 (I302_108196)
09124 Replication and repair
03420 Nucleotide excision repair
30211837 (I302_108196)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03021 Transcription machinery [BR:kbi03021]
30211837 (I302_108196)
03400 DNA repair and recombination proteins [BR:kbi03400]
30211837 (I302_108196)
Transcription machinery [BR:kbi03021]
Eukaryotic type
RNA polymerase II system
RNA polymerase II
Pol I, II, III common subunits
30211837 (I302_108196)
RNA polymerase III system
RNA polymerase III
30211837 (I302_108196)
RNA polymerase I system
RNA polymerase I
30211837 (I302_108196)
DNA repair and recombination proteins [BR:kbi03400]
Eukaryotic type
SSBR (single strand breaks repair)
NER (nucleotide excision repair)
TCR (transcription coupled repair) factors
DNA-directed RNA polymerase II complex
30211837 (I302_108196)
163 aa
MAESSNIIFEDRFTVETVDKDGKKFDRVSRITAPSHNLQMSLTLDLANELYPLDVGEVFT
LAIARTLVPDELNTAEDEDEEGNDGQSTRKIKRELWRSENMGLGEDYDYVMYGKIYKFDD
SAQGDNQTTAYFSFGGLLMALRGSYRHLAGVVVGENVYLLMRK
