Kutzneria buriramensis: Q4V65_12680 Help Entry Q4V65_12680       CDS       T10787                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism kbr  Kutzneria buriramensis Pathway kbr00998   Biosynthesis of various antibiotics kbr01100   Metabolic pathways kbr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kbr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Q4V65_12680    00074 Mycolic acid biosynthesis     Q4V65_12680   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Q4V65_12680 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  XIF75758 LinkDB All DBs Position complement(2731335..2731604) Genome browser AA seq 89 aa AA seqDB search MTASTTDVREFVLSTLAGEMNVPIDRAKVGDDSPIGTGGIDLESLSLVELTLRMEREFGV KIPDSDIEALGAMTLGQLAADIVRRKAVQ NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgaccgcgtccaccaccgacgtgcgcgagttcgtgctgagcacgctggccggcgagatg aacgtgccgattgaccgggcgaaggtcggcgacgacagcccgatcggcaccggcggcatc gacctggagtcgctcagcctggtcgagctcacactgcggatggagcgcgagttcggggtg aagatccccgactccgacatcgaggcgctcggcgcgatgacgctgggacagctggccgcc gacatcgtgcgccgcaaggccgtccagtga

DBGET integrated database retrieval system