Kosakonia calanthes: AAEY27_07425
Help
Entry
AAEY27_07425 CDS
T10644
Symbol
nuoM
Name
(GenBank) NADH-quinone oxidoreductase subunit M
KO
K00342
NADH-quinone oxidoreductase subunit M [EC:
7.1.1.2
]
Organism
kca Kosakonia calanthes
Pathway
kca00190
Oxidative phosphorylation
kca01100
Metabolic pathways
Module
kca_M00144
NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:
kca00001
]
09100 Metabolism
09102 Energy metabolism
00190 Oxidative phosphorylation
AAEY27_07425 (nuoM)
Enzymes [BR:
kca01000
]
7. Translocases
7.1 Catalysing the translocation of protons
7.1.1 Linked to oxidoreductase reactions
7.1.1.2 NADH:ubiquinone reductase (H+-translocating)
AAEY27_07425 (nuoM)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Proton_antipo_M
Oxidored_q5_N
Motif
Other DBs
NCBI-ProteinID:
WZV99698
UniProt:
A0ABZ3B8M8
LinkDB
All DBs
Position
1578316..1579845
Genome browser
AA seq
509 aa
AA seq
DB search
MLLPWLILIPFIGGFLCWQTERFGVKVPRWIALITMGLTLALSLQLWLQGGYSLTQVTGF
PQWQEEFKLDWIPRFGISIHLGMDGLSLLMVTLTGFLGVLAVLCSWREIEKYQGFFHLNL
MWILGGVIGVFLAIDMFLFFFFWEMMLVPMYFLIALWGHKASDGKTRITAATKFFIYTQA
SGLVMLIAILALVLVHYNATGVWTFDYADLLKTPMSDNVEYLLMLGFFIAFAVKMPVVPL
HGWLPDAHSQAPTAGSVDLAGILLKTAAYGLLRFSLPLFPNASAEFAPIAMWLGVIGIFY
GAWMAFNQTDIKRLIAYTSVSHMGFVLIAIYTGSQLAYQGAVIQMIAHGLSAAGLFILCG
QLYERLHTRDMRMMGGLWSKIKWLPALSMFFAVATLGMPGTGNFVGEFMILFGSYQVVPA
ITVISTFGLVFASVYSLAMLHRAYFGKAKSELANQTLPGLSLRELFMILVLVVLLVLLGF
YPQPILDTSHSAMGNIQQWFVNSVTTTRP
NT seq
1530 nt
NT seq
+upstream
nt +downstream
nt
atgttattaccctggctaatactgattccctttatcggtggcttcctttgctggcaaacc
gaacgcttcggcgtcaaggtgccgcgctggatcgcgctgatcaccatgggactgacgctg
gcgctttctctgcaactttggttgcagggtggctattcactgacgcaggtcaccggtttc
ccgcaatggcaggaagagttcaagcttgactggatcccgcgttttggcatcagcatccat
cttggtatggatggcctgtcgctgctgatggtaaccctgaccggtttcctcggcgtgctg
gcggtgctctgctcctggcgtgaaatcgaaaaatatcagggcttcttccacctgaacctg
atgtggatcctgggcggcgttatcggcgtgttccttgccatcgacatgttcctgttcttc
ttcttctgggaaatgatgctggtgccgatgtacttcctgattgcgctgtggggccacaaa
gcctccgacgggaagacgcgtattaccgcggccaccaagttcttcatttacacccaggcg
agcggtctggtgatgttgattgccatcctggcgctggtgctggtgcactacaacgcgacc
ggcgtgtggactttcgattacgctgacctgctgaaaacgccgatgtccgacaacgtcgaa
tatctgctgatgctcggtttcttcatcgccttcgcggtgaaaatgccggtggttccgctg
catggctggctgccggatgcgcactcgcaggcaccgaccgccggttctgttgacctcgcg
gggatcttgctgaaaaccgcagcctacggtctgctgcgtttctctctgccgctgttcccg
aacgcgtcggcggaatttgcgcccatcgcgatgtggcttggcgtcatcggtattttctac
ggcgcgtggatggcctttaaccagaccgatatcaaacgtctgatcgcctacacctctgtt
tcgcacatgggcttcgtgctgattgctatctacaccggcagccaactggcgtaccagggc
gcggtcatccagatgattgcgcacggtctttctgcggccggtctgttcatcctgtgtggt
cagctttacgagcgtctgcatactcgcgacatgcgcatgatgggcggcttgtggagcaaa
attaagtggttgcctgcgctgtcgatgttcttcgcggtggccacgctcggcatgccgggt
accggtaacttcgtcggtgaattcatgatcctgttcggcagctaccaagttgtgccggcc
attaccgtgatttctaccttcggtctggtcttcgcctcggtttactcgctggcgatgctg
caccgggcttacttcggtaaagcgaaaagcgaactcgctaaccagacgctgccgggactg
tcactgcgcgagctgtttatgatcctggtgctggttgtgcttttggtactgcttggcttc
tatccgcagccgattctggatacatcgcactctgcgatgggcaatatccagcagtggttt
gttaattctgttactactacaaggccgtaa
DBGET
integrated database retrieval system