Kitasatospora cathayae: O1G21_15640 Help Entry O1G21_15640       CDS       T10326                                  Name (GenBank) mycoredoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism kch  Kitasatospora cathayae Brite KEGG Orthology (KO) [BR:kch00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     O1G21_15640 Enzymes [BR:kch01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      O1G21_15640 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Glrx-like Thioredoxin_2 Thioredoxin GST_N_3 Motif Other DBs NCBI-ProteinID:  WBP87133 UniProt:  A0ABY7Q365 LinkDB All DBs Position 3559423..3559680 Genome browser AA seq 85 aa AA seqDB search MSGSVTMYSTTWCGYCNRLKSQLDREGIGYTEINIEEDPASAAFVESVNDGNQTVPTVLV EPVGGGERVVMTNPSLIQVKKALAA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgtccggcagcgtgacgatgtacagcacgacctggtgtgggtactgcaaccggctcaag agccagctggaccgtgaaggcatcggttacaccgagatcaacatcgaggaggacccggcg tcggcggccttcgtggagtcggtgaacgacggcaaccagacggtgccgacggtgctggtc gagccggtgggcggcggcgagcgggtcgtgatgacgaacccgagcctgatccaggtcaag aaggccctggccgcctga

DBGET integrated database retrieval system