Kitasatospora camelliae: ABWK59_13390 Help Entry ABWK59_13390      CDS       T11032                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism kcm  Kitasatospora camelliae Brite KEGG Orthology (KO) [BR:kcm00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:kcm03032]     ABWK59_13390    03036 Chromosome and associated proteins [BR:kcm03036]     ABWK59_13390    03400 DNA repair and recombination proteins [BR:kcm03400]     ABWK59_13390 DNA replication proteins [BR:kcm03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     ABWK59_13390 Chromosome and associated proteins [BR:kcm03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     ABWK59_13390 DNA repair and recombination proteins [BR:kcm03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       ABWK59_13390 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding Urease_beta HU-HIG Motif Other DBs NCBI-ProteinID:  XCM79839 UniProt:  A0AAU8JVI9 LinkDB All DBs Position unmamed1:complement(2987269..2987550) Genome browser AA seq 93 aa AA seqDB search MNRSELVAALAERAEVTRKDADAVLAAFAEITGEVVAKGDEKVTIPGFLTFERTLRAART ARNPQTGDPIQIPAGFSVKVSAGSKLKEAAKGK NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaaccgcagtgagctggtggccgcgctggccgagcgcgccgaggtgacccgcaaggac gccgacgccgttctggctgccttcgccgagatcacgggcgaggtcgtcgccaagggcgac gagaaggtcaccatccccggtttcctgaccttcgagcgcaccctgcgcgctgcccgcacc gcccgcaacccgcagaccggcgacccgatccagatcccggccgggttcagcgtcaaggtc agcgccggctcgaagctcaaggaagccgccaagggcaagtga

DBGET integrated database retrieval system