Kosakonia cowanii: BWI95_11120 Help Entry BWI95_11120       CDS       T04691                                  Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism kco  Kosakonia cowanii Brite KEGG Orthology (KO) [BR:kco00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:kco03032]     BWI95_11120    03036 Chromosome and associated proteins [BR:kco03036]     BWI95_11120    03400 DNA repair and recombination proteins [BR:kco03400]     BWI95_11120 DNA replication proteins [BR:kco03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     BWI95_11120 Chromosome and associated proteins [BR:kco03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     BWI95_11120 DNA repair and recombination proteins [BR:kco03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       BWI95_11120 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  APZ05554 UniProt:  A0A807LCR2 LinkDB All DBs Position 2364785..2365057 Genome browser AA seq 90 aa AA seqDB search MNKSQLIDKIAAGADISKAAAGRALDALIASVTESLQSGDDVALVGFGTFAVKERAARTG RNPQTGKEITIAAAKVPGFRAGKALKDAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt gtgaataaatctcaactgatagacaagattgccgctggcgctgacatttctaaagctgcc gccggacgcgcgttagatgcgttaattgcttctgttactgaatctttgcaatccggggac gacgtagcactggttggtttcggtacttttgcggttaaagagcgcgctgcccgtactggc cgcaacccgcaaaccggcaaagagattactattgctgctgccaaagtccctggcttccgc gcaggtaaagcgctgaaagacgccgtgaactaa

DBGET integrated database retrieval system