Candidatus Korarchaeum cryptofilum: Kcr_1336 Help Entry Kcr_1336          CDS       T00668                                  Name (GenBank) Ribosomal protein S27a   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism kcr  Candidatus Korarchaeum cryptofilum Pathway kcr03010   Ribosome Brite KEGG Orthology (KO) [BR:kcr00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     Kcr_1336   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     Kcr_1336  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:kcr03011]     Kcr_1336    04121 Ubiquitin system [BR:kcr04121]     Kcr_1336   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:kcr04147]     Kcr_1336 Ribosome [BR:kcr03011]  Ribosomal proteins   Eukaryotes    Small subunit     Kcr_1336   Archaea     Kcr_1336 Ubiquitin system [BR:kcr04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    Kcr_1336 Exosome [BR:kcr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    Kcr_1336   Exosomal proteins of colorectal cancer cells    Kcr_1336 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 EDR4-like_1st Zn_ribbon_NrdR Zn_Ribbon_TF C1_2 Zn_ribbon_IS1595 zf_UBZ Cas12f1-like_TNB Motif Other DBs NCBI-ProteinID:  ACB08082 UniProt:  B1L6K3 LinkDB All DBs Position complement(1335822..1335983) Genome browser AA seq 53 aa AA seqDB search MKHKPVQAWKYYSVEGGKLVRKRRQCPRCGRFMAEHENRYSCGGCGYTEFKGK NT seq 162 nt NT seq  +upstreamnt  +downstreamnt ttgaagcataagcccgtccaagcttggaagtactactcggtggaagggggtaagctggtg aggaagaggaggcagtgcccaaggtgcggccgcttcatggcggagcacgagaataggtac agctgcgggggatgcggttacacagaattcaaggggaagtga

DBGET integrated database retrieval system