Kluyvera cryocrescens: RIN60_21900 Help Entry RIN60_21900       CDS       T09399                                  Symbol ppiC Name (GenBank) peptidylprolyl isomerase PpiC   KO K03769   peptidyl-prolyl cis-trans isomerase C [EC:5.2.1.8] Organism kcy  Kluyvera cryocrescens Brite KEGG Orthology (KO) [BR:kcy00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:kcy03110]     RIN60_21900 (ppiC) Enzymes [BR:kcy01000]  5. Isomerases   5.2  cis-trans-Isomerases    5.2.1  cis-trans Isomerases (only sub-subclass identified to date)     5.2.1.8  peptidylprolyl isomerase      RIN60_21900 (ppiC) Chaperones and folding catalysts [BR:kcy03110]  Protein folding catalysts   Peptidyl prolyl isomerase    Parvulin     RIN60_21900 (ppiC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Rotamase_3 Rotamase Rotamase_2 Motif Other DBs NCBI-ProteinID:  WNN71628 LinkDB All DBs Position 4656005..4656286 Genome browser AA seq 93 aa AA seqDB search MAKTAAALHILVKEEQLALDLLEQIKNGADFEKLAKKHSTCPSGKKGGHLGEFRQGQMVP AFDKVVFSCPVLEPTGPLHTQFGYHIIKVLYRN NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggctaaaacagcagcagcactgcatatccttgtaaaagaagaacaactggcactggat cttctggaacagattaaaaacggcgccgattttgagaagctggcgaaaaagcactcgacc tgcccatcaggtaagaaaggcggtcacctgggcgaattccgtcagggccagatggtaccg gcattcgataaagtggtgttctcctgcccagtgctggaaccaaccggcccgctgcacacg cagttcggctaccacatcattaaggtcctgtaccgtaactaa

DBGET integrated database retrieval system