Candidatus Kirkpatrickella diaphorinae: N5W20_01580 Help Entry N5W20_01580       CDS       T09554                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism kdp  Candidatus Kirkpatrickella diaphorinae Pathway kdp01100   Metabolic pathways kdp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kdp00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     N5W20_01580    00074 Mycolic acid biosynthesis     N5W20_01580   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     N5W20_01580 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N DUF1493 Motif Other DBs NCBI-ProteinID:  UYH51597 UniProt:  A0ABY6GJV1 LinkDB All DBs Position 339330..339569 Genome browser AA seq 79 aa AA seqDB search MSEITRKVQKIVVEHLGAEESKVTPEASFIDDLGADSLDTVELVMAFEEEFGVEIPEQDA EKIATVKDAIDFIEKKRED NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagtgaaatcacccgtaaggttcagaagatcgtcgttgaacatctcggcgctgaagaa agtaaagtgacgccggaagcgtcttttatcgatgacctcggtgcggatagtcttgatacg gttgaactcgtcatggcttttgaagaggaattcggcgttgaaatccccgagcaggatgcc gaaaaaatcgcgactgtgaaggatgcgatcgacttcattgaaaagaagagagaggactga

DBGET integrated database retrieval system