Kroppenstedtia eburnea: GXN75_02275 Help Entry GXN75_02275       CDS       T06618                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism keb  Kroppenstedtia eburnea Pathway keb00998   Biosynthesis of various antibiotics keb01100   Metabolic pathways keb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:keb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GXN75_02275    00074 Mycolic acid biosynthesis     GXN75_02275   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GXN75_02275 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  QKI80918 LinkDB All DBs Position 415002..415265 Genome browser AA seq 87 aa AA seqDB search MTKEKVKQMFIDCFELSMTKDELKDDVALFGPNSPFGLDSMDILKFITIIKDEFQINLGS IRTDTFSTVNQITQTIEEHQGAPAQNS NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgacgaaagagaaggttaagcaaatgtttattgactgcttcgagctgtccatgaccaag gatgagttaaaagatgatgtcgcgctcttcgggcccaattccccctttggtctggattct atggatatcctgaagtttatcacgattataaaggatgaatttcagattaatctgggctcg atcagaacggacaccttcagcacggtaaaccaaatcactcaaaccatagaggagcaccaa ggggctccagctcaaaattcatag

DBGET integrated database retrieval system