Komagataeibacter europaeus: S101446_01997 Help Entry S101446_01997     CDS       T04893                                  Name (GenBank) hypothetical protein   KO K03073   preprotein translocase subunit SecE Organism keu  Komagataeibacter europaeus Pathway keu02024   Quorum sensing keu03060   Protein export keu03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:keu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     S101446_01997  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     S101446_01997  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     S101446_01997  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:keu02044]     S101446_01997 Secretion system [BR:keu02044]  Sec (secretion) system   Prokaryotic Sec-SRP core components    S101446_01997 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SecE Motif Other DBs NCBI-ProteinID:  ARW17111 UniProt:  A0A0M0EI68 LinkDB All DBs Position 2163030..2163224 Genome browser AA seq 64 aa AA seqDB search MSVSPAKFVEDVRAEARKVTWPTRRATLMTTGAVLAMAGLASVFFFLVDEVIGLAVRKLF GLGG NT seq 195 nt NT seq  +upstreamnt  +downstreamnt gtgtcggtcagtcccgcgaaatttgttgaagacgtccgtgccgaggccagaaaggtcaca tggcccacccgacgcgccaccctgatgacaacgggtgcggttctggccatggccggtctt gcatcggttttctttttcctcgtcgacgaggtgatcggccttgccgtacggaaactcttc ggactgggaggctga

DBGET integrated database retrieval system