Kocuria flava: AS188_02995
Help
Entry
AS188_02995 CDS
T04206
Name
(GenBank) single-stranded DNA-binding protein
KO
K03111
single-strand DNA-binding protein
Organism
kfv
Kocuria flava
Pathway
kfv03030
DNA replication
kfv03430
Mismatch repair
kfv03440
Homologous recombination
Brite
KEGG Orthology (KO) [BR:
kfv00001
]
09120 Genetic Information Processing
09124 Replication and repair
03030 DNA replication
AS188_02995
03430 Mismatch repair
AS188_02995
03440 Homologous recombination
AS188_02995
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03032 DNA replication proteins [BR:
kfv03032
]
AS188_02995
03400 DNA repair and recombination proteins [BR:
kfv03400
]
AS188_02995
03029 Mitochondrial biogenesis [BR:
kfv03029
]
AS188_02995
DNA replication proteins [BR:
kfv03032
]
Prokaryotic type
DNA Replication Initiation Factors
Initiation factors (bacterial)
AS188_02995
DNA repair and recombination proteins [BR:
kfv03400
]
Prokaryotic type
SSBR (single strand breaks repair)
MMR (mismatch excision repair)
Other MMR factors
AS188_02995
TLS (translesion DNA synthesis) factors
Other SOS response factors
AS188_02995
Mitochondrial biogenesis [BR:
kfv03029
]
Mitochondrial DNA transcription, translation, and replication factors
Mitochondrial DNA replication factors
Other Mitochondrial DNA replication factors
AS188_02995
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
SSB
tRNA_anti-codon
tRNA_anti_2
SSB_1
Motif
Other DBs
NCBI-ProteinID:
ALU38881
UniProt:
A0A0U2YTM6
LinkDB
All DBs
Position
646711..647364
Genome browser
AA seq
217 aa
AA seq
DB search
MAGDTVITVIGNLTADPELRFTPSGAAVANFTVASTPRTFDRQSNEWKDGETLFLRCSVW
REAAENVAESLQKGMRVIVQGRLKSRSYDTKEGERRTVTELDVDEVGPSLRYASAKVTRN
ARGGGQGGGFGGGGGGQQSGGFGGGGGGFGGGQQSGGGGFGGDSGSGFGGQQSGGGFGGG
RGGGRPAQQPAPQGDPWSQSSGGNYDWGTGQDDEPPF
NT seq
654 nt
NT seq
+upstream
nt +downstream
nt
atggctggtgacaccgtcatcacagtgatcggcaacctgaccgccgaccccgagctgcgc
ttcaccccgtcgggtgcggccgtggccaacttcaccgttgcgtccacgccccgcaccttc
gaccgccagtccaacgagtggaaggacggggagaccctgttcctgcgctgctcggtgtgg
cgcgaggcggccgagaacgtggcggagtccctgcagaagggcatgcgcgtgatcgtgcag
ggtcggctgaagtcgcgctcgtacgacaccaaggaaggcgagcggcgcaccgtcacggag
ctcgacgtcgacgaggtcggtccctcgctgcgctacgcctccgccaaggtcacccgcaac
gcccgcggaggcgggcagggcggcggcttcggcggcggcggtggcggccagcagtccggc
ggcttcggtggcggtggcggcggcttcggcggcggccagcagtccggcggcggcgggttc
gggggcgactccgggtccggcttcggcgggcagcagtccggcggcggcttcggcggcggc
cgcggtggcggccggcccgcccagcagcccgcgccccagggcgacccctggagccagtcc
tccggcggcaactacgactggggcaccggtcaggacgacgagccgccgttctag
DBGET
integrated database retrieval system