KEGG   Kocuria flava: AS188_02995
Entry
AS188_02995       CDS       T04206                                 
Name
(GenBank) single-stranded DNA-binding protein
  KO
K03111  single-strand DNA-binding protein
Organism
kfv  Kocuria flava
Pathway
kfv03030  DNA replication
kfv03430  Mismatch repair
kfv03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:kfv00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AS188_02995
   03430 Mismatch repair
    AS188_02995
   03440 Homologous recombination
    AS188_02995
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:kfv03032]
    AS188_02995
   03400 DNA repair and recombination proteins [BR:kfv03400]
    AS188_02995
   03029 Mitochondrial biogenesis [BR:kfv03029]
    AS188_02995
DNA replication proteins [BR:kfv03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    AS188_02995
DNA repair and recombination proteins [BR:kfv03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Other MMR factors
     AS188_02995
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    AS188_02995
Mitochondrial biogenesis [BR:kfv03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Other Mitochondrial DNA replication factors
    AS188_02995
SSDB
Motif
Pfam: SSB tRNA_anti-codon tRNA_anti_2 SSB_1
Other DBs
NCBI-ProteinID: ALU38881
UniProt: A0A0U2YTM6
LinkDB
Position
646711..647364
AA seq 217 aa
MAGDTVITVIGNLTADPELRFTPSGAAVANFTVASTPRTFDRQSNEWKDGETLFLRCSVW
REAAENVAESLQKGMRVIVQGRLKSRSYDTKEGERRTVTELDVDEVGPSLRYASAKVTRN
ARGGGQGGGFGGGGGGQQSGGFGGGGGGFGGGQQSGGGGFGGDSGSGFGGQQSGGGFGGG
RGGGRPAQQPAPQGDPWSQSSGGNYDWGTGQDDEPPF
NT seq 654 nt   +upstreamnt  +downstreamnt
atggctggtgacaccgtcatcacagtgatcggcaacctgaccgccgaccccgagctgcgc
ttcaccccgtcgggtgcggccgtggccaacttcaccgttgcgtccacgccccgcaccttc
gaccgccagtccaacgagtggaaggacggggagaccctgttcctgcgctgctcggtgtgg
cgcgaggcggccgagaacgtggcggagtccctgcagaagggcatgcgcgtgatcgtgcag
ggtcggctgaagtcgcgctcgtacgacaccaaggaaggcgagcggcgcaccgtcacggag
ctcgacgtcgacgaggtcggtccctcgctgcgctacgcctccgccaaggtcacccgcaac
gcccgcggaggcgggcagggcggcggcttcggcggcggcggtggcggccagcagtccggc
ggcttcggtggcggtggcggcggcttcggcggcggccagcagtccggcggcggcgggttc
gggggcgactccgggtccggcttcggcgggcagcagtccggcggcggcttcggcggcggc
cgcggtggcggccggcccgcccagcagcccgcgccccagggcgacccctggagccagtcc
tccggcggcaactacgactggggcaccggtcaggacgacgagccgccgttctag

DBGET integrated database retrieval system