Kluyvera genomosp. 3: GY169_10310 Help Entry GY169_10310       CDS       T11119                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism kgn  Kluyvera genomosp. 3 Pathway kgn01100   Metabolic pathways kgn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kgn00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GY169_10310    00074 Mycolic acid biosynthesis     GY169_10310   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GY169_10310 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding COX2-transmemb Motif Other DBs NCBI-ProteinID:  QIR27168 UniProt:  A0A6G9RK95 LinkDB All DBs Position 2213383..2213628 Genome browser AA seq 81 aa AA seqDB search MRKIEQNVVGTVNNIIAQALCCDIEQVTKDKDMYYDLLADSLAMIDIFVALEQTYSIAYT EEDITKIERVEDIYHFVNVHI NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgagaaaaatagaacaaaatgttgtaggtaccgtgaataatattattgctcaagcatta tgttgtgatattgagcaggtcactaaagataaagatatgtattacgatcttttggccgac tcattagcaatgattgatatttttgttgcgctggagcaaacgtattcgattgcttataca gaagaagatataacaaaaatagaacgcgtggaggatatatatcattttgtcaatgttcac atttag

DBGET integrated database retrieval system