Kluyvera genomosp. 3: CEW81_14865 Help Entry CEW81_14865       CDS       T04930                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism kgo  Kluyvera genomosp. 3 Pathway kgo01100   Metabolic pathways kgo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kgo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CEW81_14865    00074 Mycolic acid biosynthesis     CEW81_14865   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CEW81_14865 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB HLH Motif Other DBs NCBI-ProteinID:  ASG64571 UniProt:  A0A248KL34 LinkDB All DBs Position complement(2980676..2980912) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaatcatcggcgaacagctgggcgttaagcag gaagaagtgaccaacaatgcttccttcgttgaagacctgggcgcagattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggtcaccaggcgtaa

DBGET integrated database retrieval system