Kerstersia gyiorum: EHF36_02460 Help Entry EHF36_02460       CDS       T05924                                  Symbol ftsL Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism kgy  Kerstersia gyiorum Brite KEGG Orthology (KO) [BR:kgy00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:kgy03036]     EHF36_02460 (ftsL) Chromosome and associated proteins [BR:kgy03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     EHF36_02460 (ftsL) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL TarH ERM_helical NrS1-1_pol-like_head Motif Other DBs NCBI-ProteinID:  QBR39622 LinkDB All DBs Position 564027..564314 Genome browser AA seq 95 aa AA seqDB search MTRVLFVLGLLLMLSAASLVTSQYQGRRAFIELERARAQANDLDLEWRRLQLERAGLARN ARVDDVAVNELQMVPVDPQRALYFNAPAAAQPGGS NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgactcgcgtcctgttcgtcctgggcttgttgctcatgctctcggccgcttccctggtg accagccagtaccaggggcggcgggcgttcatcgaactggaacgcgcacgcgcccaggcc aacgatctggacctggagtggcgccgtttgcaactggagcgtgccgggctggcgcgcaat gccagggtggatgatgttgcagtcaacgaactgcagatggtaccggtggacccccagcgg gcgttgtatttcaatgcccccgctgcagcgcaaccagggggctcatga

DBGET integrated database retrieval system