Novacetimonas hansenii: IFJ82_11425 Help Entry IFJ82_11425       CDS       T06979                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism kha  Novacetimonas hansenii Pathway kha01100   Metabolic pathways kha01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kha00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     IFJ82_11425    00074 Mycolic acid biosynthesis     IFJ82_11425   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     IFJ82_11425 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  QOF94514 LinkDB All DBs Position 2620113..2620364 Genome browser AA seq 83 aa AA seqDB search MSETVADVSAIIVQTLLANPKVPRDINGGSKIVEDLAFDSLAVMNFVMEIEDKLDVSVPL DRLADIRTIDDLAACIVSLKQAS NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgagtgaaacggtagcggacgtctcggccatcattgtgcagacactgctggcgaacccc aaggttccccgtgatatcaatggcggcagcaagatcgtcgaggatctggctttcgattca ctggccgtcatgaatttcgtcatggaaatcgaggacaagctcgacgtctccgtccccctc gaccggctggcggatatccgcacgattgatgatctggccgcctgtatcgtttccctcaaa caggcgtcctga

DBGET integrated database retrieval system