Novacetimonas hansenii: IFJ82_14535 Help Entry IFJ82_14535       CDS       T06979                                  Name (GenBank) aldo/keto reductase   KO K00002   alcohol dehydrogenase (NADP+) [EC:1.1.1.2] Organism kha  Novacetimonas hansenii Pathway kha00010   Glycolysis / Gluconeogenesis kha00040   Pentose and glucuronate interconversions kha00053   Ascorbate and aldarate metabolism kha00561   Glycerolipid metabolism kha00620   Pyruvate metabolism kha00930   Caprolactam degradation kha01100   Metabolic pathways kha01110   Biosynthesis of secondary metabolites kha01120   Microbial metabolism in diverse environments kha01220   Degradation of aromatic compounds kha01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:kha00001]  09100 Metabolism   09101 Carbohydrate metabolism    00010 Glycolysis / Gluconeogenesis     IFJ82_14535    00040 Pentose and glucuronate interconversions     IFJ82_14535    00053 Ascorbate and aldarate metabolism     IFJ82_14535    00620 Pyruvate metabolism     IFJ82_14535   09103 Lipid metabolism    00561 Glycerolipid metabolism     IFJ82_14535   09111 Xenobiotics biodegradation and metabolism    00930 Caprolactam degradation     IFJ82_14535  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:kha04147]     IFJ82_14535 Enzymes [BR:kha01000]  1. Oxidoreductases   1.1  Acting on the CH-OH group of donors    1.1.1  With NAD+ or NADP+ as acceptor     1.1.1.2  alcohol dehydrogenase (NADP+)      IFJ82_14535 Exosome [BR:kha04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    IFJ82_14535 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Aldo_ket_red Motif Other DBs NCBI-ProteinID:  QOF95013 LinkDB All DBs Position complement(3320536..3320808) Genome browser AA seq 90 aa AA seqDB search MDEADFSTDNIRVVLSIATTHDRPPAQIVLRWHRKQGLVPLPKTATATRLPENLAVWDFE LDENDMLQLLRLDRPHGNTQPLPDGRNSSF NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atggacgaagcagatttttcaacggacaatatccgcgtcgtgctgtcgattgccaccacg catgatcgcccgcctgcgcagatcgtccttcgctggcaccgtaaacaagggctggttccc ttgccgaagacggctacggccactcgcctgccggagaacctggctgtgtgggatttcgaa cttgacgagaacgacatgctgcaactgctccggctagaccggccacacggcaacacccag ccgcttcccgacggcaggaactcttcattctga

DBGET integrated database retrieval system