KEGG   Kinneretia sp. DAIF2: G8A07_07130
Entry
G8A07_07130       CDS       T06904                                 
Name
(GenBank) N-acetyl sugar amidotransferase
  KO
K24259  putative aminotransferase
Organism
kia  Kinneretia sp. DAIF2
Pathway
kia00541  O-Antigen nucleotide sugar biosynthesis
kia01100  Metabolic pathways
kia01250  Biosynthesis of nucleotide sugars
Module
kia_M00923  UDP-L-FucNAm biosynthesis
Brite
KEGG Orthology (KO) [BR:kia00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    G8A07_07130
SSDB
Motif
Pfam: NAD_synthase Asn_synthase QueC ATP_bind_3 DUF2316 tRNA_Me_trans
Other DBs
NCBI-ProteinID: QPF72725
UniProt: A0A7S9GGT3
LinkDB
Position
complement(1529589..1530740)
AA seq 383 aa
MSTDTYKPYRICTRCIMDTSDPNIRFDEHGHCDYCNNFDATIKPNWHTGTEGERQLAQMA
DAIREAGKGKDFDCIIGLSGGLDSSYAAYIAKEKMGLRPLLFHVDAGWNTDQAVGNIEKL
VDGLGLDLYTEVINWEEMKDLQAAFLKSGIPDQDLPQDASFFSSLYKFARQHKIKHVITG
SNFSTECCREPEEWGGYLGIDTLLFNDIHRQFGKRRLDTFPLKDILVYKLYYQKILGMKV
HHPLNLVPFGKKQAEDELERRFGWQRFQHKHHESRFTRFYEDYWLPRRFGFHKRRAHFSS
LIMTGQMTREAALDRISRPEMDEHFLKQEFEYVAHKLDLTVEELQQIFELPKKTYRDYRN
KRWMIGFGANAMRWLGLEKRYFR
NT seq 1152 nt   +upstreamnt  +downstreamnt
atgagcaccgatacctacaagccttaccgcatctgcacccgctgcatcatggacacgtcc
gatccgaacatccggttcgacgagcacggccactgcgactactgcaacaacttcgacgcc
accattaagcccaactggcacaccgggactgaaggcgagcgccagctcgcgcagatggcc
gacgccatccgcgaggcaggcaagggcaaagacttcgactgcatcatcggcctgagcggc
ggcctggacagctcctacgcggcctacatcgccaaggaaaagatgggcttgcgcccactg
ctcttccacgtcgacgccggctggaacaccgaccaggccgtgggcaatatcgagaagctg
gtggacggtctcggcctcgacctctacaccgaggtcatcaactgggaagagatgaaggac
ctgcaggccgccttcctgaagtcgggcatccccgaccaggacttgccgcaggacgcctcc
ttcttctcgtcgctgtacaagttcgcgcgccagcacaagatcaagcacgtcatcaccggc
tcgaacttctcgaccgagtgctgccgcgagcccgaggaatggggtggctacctcggcatc
gacacgctgctcttcaacgacatccaccgccagttcggtaagcgtcgcctggacaccttc
ccgctcaaggacatcctggtctacaagctgtactaccagaagatcctcggcatgaaggtg
catcacccgctgaacctcgtgcccttcggaaagaagcaggccgaggacgagctggagcgc
cgcttcggctggcagcgcttccagcacaagcaccacgagtcgcgcttcacgcgattctac
gaggactactggctgccgcgccgcttcggcttccacaagcgccgcgcgcacttctccagc
ctgatcatgacgggccagatgacgcgcgaggccgcgctggaccgcatttcgcggccggag
atggacgagcacttcctgaagcaggagttcgagtacgtcgcccacaagctcgacctcacc
gtcgaggaactgcagcagatcttcgagctgcccaagaagacctaccgcgactaccgcaac
aagcgctggatgatcggcttcggcgccaatgcgatgcgctggctgggactggaaaagagg
tacttccgatga

DBGET integrated database retrieval system