Roseateles sp. DAIF2: G8A07_07300 Help Entry G8A07_07300       CDS       T06904                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism kia  Roseateles sp. DAIF2 Pathway kia01100   Metabolic pathways kia01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kia00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     G8A07_07300 (acpP)    00074 Mycolic acid biosynthesis     G8A07_07300 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     G8A07_07300 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N DUF1896 Motif Other DBs NCBI-ProteinID:  QPF72757 UniProt:  A0A7S9GHP4 LinkDB All DBs Position 1564439..1564678 Genome browser AA seq 79 aa AA seqDB search MSDIEARVKKIIAEQLGVPESDVTNEKAFVADLGADSLDTVELVMALEDEFGIEIPDEEA EKITTVQLAIDYAVKHQKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgaagcacgtgtcaagaaaatcatcgccgagcaactcggcgtgcctgag tccgacgtcaccaatgagaaggccttcgtggccgatctgggcgccgactcgctggacacc gtggaactggtgatggctctcgaagacgagttcggcatcgagatcccggacgaagaggcc gagaagatcaccaccgtgcagctggcgatcgactacgccgtcaagcaccagaaggcctga

DBGET integrated database retrieval system