KEGG   Kinneretia sp. DAIF2: G8A07_12215
Entry
G8A07_12215       CDS       T06904                                 
Name
(GenBank) hypothetical protein
  KO
K21785  4-hydroxy-2,2'-bipyrrole-5-methanol dehydrogenase
Organism
kia  Kinneretia sp. DAIF2
Pathway
kia00333  Prodigiosin biosynthesis
kia01100  Metabolic pathways
kia01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kia00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    G8A07_12215
SSDB
Motif
Pfam: Nitroreductase TM1586_NiRdase Asparaginase_II
Other DBs
NCBI-ProteinID: QPF73612
UniProt: A0A7S9GIJ2
LinkDB
Position
complement(2642816..2643937)
AA seq 373 aa
MSMRIEAMLSRLKPLLALAALAPSSHNSQPWHVRALSLLQEGEPADEAQLQLSPGWPLAL
CLELDHQRRLRALPSLQREMLISLGGFAAILLNLLRLSGWAVEACSMGRHTSGVLLRLGS
GPRPERADPAALARLTQALQRRQTERGPYRAEQPLRFDCNERLLPHGLGLSSATQHWRLL
DDAAGRGAVAAFYAEHAARDLLHRSAWSETYAHLHFGADTDAAAGAQQGIAIERLFGPMS
PWRRRSLQLLLHPALVARLGPRGMAARVGATLQALIGSSPALLYLAGPPTHEPAAALLQA
GARIADLWLLAASHGQALHPLSVALQHEDLRRRLSGLLGCSEELLFIARAGTPREPLPAP
RHRRRPPEAFLTA
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgtcgatgaggatcgaggcgatgctgtcccggctcaagccgctcctggccctggccgcg
ttggcgccctcctcgcacaacagccagccctggcatgtgcgcgcgctgtcgctgctgcag
gaaggcgagccggccgacgaggcccagctgcagctgagcccgggctggccgctggccctg
tgcctcgagctggaccatcagcgccgcctgcgggcgctgccctcgctgcagcgcgagatg
ctgatcagcctgggcggcttcgccgccatcctgctgaacctgctgcgcctgtcgggctgg
gcggtcgaggcctgcagcatgggccgccacaccagcggcgtgctgctgcgcctgggctcc
ggcccgcggcccgagcgcgccgacccggccgcgctggcgcggctcacccaggccctgcag
cggcgccagaccgagcgcggcccctaccgcgccgagcagccgctgcgcttcgactgcaac
gagcgcctgctgccgcatggcctgggcctgtccagcgcgacccagcattggcgcctgctg
gacgatgccgccggccgcggcgccgtcgcggccttctatgccgagcatgcggcgcgcgac
ctgctgcaccgctcggcctggagcgagacctacgcccatctgcatttcggcgccgacacc
gatgccgccgccggcgcgcagcagggcatcgcgatcgagcgcctgttcggcccgatgagt
ccctggcgccgccgctcgctgcagctgctgctgcatccggccctggtcgcgcgcctgggt
ccgcgcggcatggcggcccgcgtcggcgccacgctgcaggccctgatcggcagcagcccg
gccctgctctacctggccgggccgccgacgcatgagccggccgccgcgctgctgcaggcc
ggcgcccgtatcgccgatctttggctgctggccgccagccacggccaggccctacatccg
ctcagcgtcgcgctgcagcacgaggacctgcgccgccgcctgagcggcctgctgggctgc
agcgaggagctgctgttcatcgcccgggccggcacgccgcgcgagcccctgcccgcgccg
cgccaccgacgccgcccgcccgaagcctttctgaccgcctga

DBGET integrated database retrieval system