Roseateles sp. DAIF2: G8A07_17185 Help Entry G8A07_17185       CDS       T06904                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism kia  Roseateles sp. DAIF2 Brite KEGG Orthology (KO) [BR:kia00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:kia03032]     G8A07_17185    03036 Chromosome and associated proteins [BR:kia03036]     G8A07_17185    03400 DNA repair and recombination proteins [BR:kia03400]     G8A07_17185 DNA replication proteins [BR:kia03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     G8A07_17185 Chromosome and associated proteins [BR:kia03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     G8A07_17185 DNA repair and recombination proteins [BR:kia03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       G8A07_17185 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 UBA_HYPK HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  QPF76669 UniProt:  A0A7S9GKM6 LinkDB All DBs Position complement(3705216..3705509) Genome browser AA seq 97 aa AA seqDB search MLLRGLFVNKSELIEHIAKQADISKAAAGRALEALIGGVKTTLKKSGSVSLVGFGTFSVS KRAARSGRNPRTGDTIKIKAAKVPKFRPGKALKDAVN NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atccttttgagggggttatttgtgaacaagtccgaactgatcgagcacatcgccaagcag gccgatatttccaaggccgccgccgggcgtgcgctggaggcgctgattggcggcgtcaag acgacgctgaagaagagtggcagcgtgtccctggtgggtttcggaacgttcagcgtcagc aagcgcgcggctcgcagcggccgcaacccccgcaccggcgacacgatcaagatcaaggcc gccaaggtgccgaagttccgccccggcaaggcgctcaaggacgcggtcaactaa

DBGET integrated database retrieval system