Kitasatospora sp. CMC57: KCMC57_up45350 Help Entry KCMC57_up45350    CDS       T11196                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism kic  Kitasatospora sp. CMC57 Pathway kic01100   Metabolic pathways kic01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kic00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KCMC57_up45350    00074 Mycolic acid biosynthesis     KCMC57_up45350   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KCMC57_up45350 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  BFV59431 LinkDB All DBs Position complement(5079534..5079782) Genome browser AA seq 82 aa AA seqDB search MATKDEVLTGLAEIVNEIAGIPAEDVELDKSFTDDLDVDSLSMVEVVVAAEERFDVKIPD DEVKNLKTVGNAVDYILANAAA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggctaccaaggacgaggttctgaccggtcttgccgagatcgtcaacgagatcgcgggc atcccggccgaggacgtcgagctcgacaagtccttcacggacgacctggacgtcgactcg ctctccatggtcgaggtcgtcgtggccgccgaggagcgcttcgacgtcaagatcccggac gacgaggtcaagaacctcaagaccgtcggcaacgccgtggactacatcctcgcgaacgcc gccgcctga

DBGET integrated database retrieval system